DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33477 and CG33476

DIOPT Version :9

Sequence 1:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:152 Identity:90/152 - (59%)
Similarity:123/152 - (80%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RGNAEYSLESLDTRCDHDFVEYFHRVPDSKILYTFRVVKLAPAFTINITIKVLKTHRIMYKIENF 111
            ||.:::.:|||.|.|||:||||||:.||...:|||||||||.||||:..::|:||.|:|||::||
  Fly    14 RGGSKFIMESLATSCDHNFVEYFHKAPDMVDIYTFRVVKLAKAFTIDFAVRVVKTKRVMYKVDNF 78

  Fly   112 KGCEFLNNPVIFKMFGESYKTLVVNGSYFKCPIKPNVYYLKTDGIMSMIPSVHPFGRFQLSMRVK 176
            .||:||.||::.::||..||.||||||:|.|||||.|||::.:|.::|:|...|.||:|::|||:
  Fly    79 DGCQFLMNPLMNRVFGTVYKRLVVNGSFFSCPIKPGVYYIRNEGSVAMLPVFQPPGRYQITMRVR 143

  Fly   177 MKESRKPFVMEMLLNYTIVRIK 198
            |:|||.|||||||..|::||||
  Fly   144 MRESRDPFVMEMLWVYSVVRIK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33477NP_995797.1 DUF1091 100..171 CDD:284008 39/70 (56%)
CG33476NP_995798.2 DUF1091 57..138 CDD:284008 43/80 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449920
Domainoid 1 1.000 45 1.000 Domainoid score I19322
eggNOG 1 0.900 - - E1_2FA6J
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014251
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.