DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33477 and CG33475

DIOPT Version :9

Sequence 1:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster


Alignment Length:173 Identity:48/173 - (27%)
Similarity:77/173 - (44%) Gaps:27/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ISVICLNL-VKYLTIPQPIAVQRGNAEYSLESLDTRCDHDFVEYFHRVPDSKILYTFRVVKLAPA 89
            :..:||.| :||         .|.|                |:||..||...........||...
  Fly     1 MKAVCLGLELKY---------NRSN----------------VDYFGLVPGESQKMMINSTKLFKN 40

  Fly    90 FTINITIKVLKTHRIMYKIENFKGCEFLNNPVIFKMFGESYKTLVVNGSYFKCPIKPNVYYLKTD 154
            ..::..|:...::|.:|.|:|...|.||||.:|.|::...|:..|.|.:.|:||::|:||||...
  Fly    41 IFLDNRIQNAVSNRTIYNIKNLAICNFLNNRLISKVYSVIYEGFVGNSTVFRCPVQPSVYYLSNS 105

  Fly   155 GIMSMIPSVHPFGRFQLSMRVKMKESRKPFVMEMLLNYTIVRI 197
            .....:|..|..|.|:|.:::| .|.....:.|::..|.:.||
  Fly   106 VREFEVPIFHQPGMFRLYVKLK-AEKEGNMLTELIWRYRVRRI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33477NP_995797.1 DUF1091 100..171 CDD:284008 26/70 (37%)
CG33475NP_995799.1 DUF1091 54..122 CDD:284008 26/67 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449922
Domainoid 1 1.000 45 1.000 Domainoid score I19322
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014251
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.