DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33477 and CG30050

DIOPT Version :10

Sequence 1:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster


Alignment Length:146 Identity:20/146 - (13%)
Similarity:53/146 - (36%) Gaps:39/146 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NLVKYLTIPQPIAVQRGNAEYSLESLDTRCDHDFVEYFHRV--PDSKIL-YTFRVVKLAPAFTIN 93
            |:..|:.:.|...|  ||..|            |...:.|:  |.::.: .:..:::....|:.:
  Fly    26 NMGYYIEMKQMDCV--GNPNY------------FANLYCRIIPPKNRTMEASVNIMQQLSVFSGS 76

  Fly    94 ITIKVLKTHRIMYKIEN--FKGCEFLNNPVIFKMFGESYKTLVV-----------NGSYFKCPIK 145
            :.:.:....:::.:|.:  |..|         |:..|..:.:::           |...::||..
  Fly    77 LRVSIPNAKKVITQIFDITFDVC---------KVLRERKRKILIDLLVNTLAKNSNAKAWRCPFP 132

  Fly   146 PNVYYLKTDGIMSMIP 161
            ...:..:...:..:.|
  Fly   133 KGKFESRNISVTDLPP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 9/75 (12%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 9/68 (13%)

Return to query results.
Submit another query.