DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33475 and CG14518

DIOPT Version :10

Sequence 1:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:163 Identity:36/163 - (22%)
Similarity:64/163 - (39%) Gaps:43/163 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVCLGLELKYNRSNVDYFGLVPGESQKMMINSTKLFKNIFLDNRIQNAVSNRTI----------- 56
            |||    ..||:|.|: |||    .:...::..|:..|:  |..:.:.|.:..:           
  Fly    30 AVC----ETYNKSWVE-FGL----CRLRAVSRNKVCLNV--DANLLHPVHDVIVKARLLKRANGY 83

  Fly    57 ----YNIKNLAICNFL---NNRLISKVYSVIYEGFVGNSTV-FRCPV----QPSVYYLSNSVREF 109
                |:: :...|.|:   ||.||    .:::|.|...||: ..||.    |...:||    |..
  Fly    84 KPWLYSV-SFDGCQFIRRRNNALI----RIVWELFKEYSTINHTCPYVGLQQVKNFYL----RSE 139

  Fly   110 EVPIFHQPGMFRLYVKLKAEKEGNMLTELIWRY 142
            ::|.....|.:.|.:.....|:....|.:.:.:
  Fly   140 KLPTPIPTGEYLLMIDWVFNKKPQAATNVYFTF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 19/92 (21%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 22/99 (22%)

Return to query results.
Submit another query.