DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33475 and CG33640

DIOPT Version :10

Sequence 1:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster


Alignment Length:125 Identity:29/125 - (23%)
Similarity:57/125 - (45%) Gaps:17/125 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SQKMMINSTKLFKNIFLDNRIQNAVSNR---TIYNIKNLAICNFLNNRLISKVYSVIYEGFVG-N 87
            |..||||  :|..::.|.:.:......|   .:||:: |..|:.|||...:|...::|..:.. .
  Fly    56 SGHMMIN--RLVNDLTLTSSMDITRPQRPELRLYNVQ-LNFCSVLNNGYKNKFIRMLYNNYAQFL 117

  Fly    88 STVFRCPVQPSVYYLSNS--VREFEVPIFHQPGMFRLYVKLKAEK--------EGNMLTE 137
            :|..:||::|:..|..:.  :.|..:|.......:||.:..|.:.        :|.:|::
  Fly   118 NTKPKCPLKPNFNYSLHRAYIDEAMLPDLLPECTYRLKMSFKHKSKLLAHMQIDGRLLSK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 17/75 (23%)
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 17/81 (21%)

Return to query results.
Submit another query.