DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33475 and CG33795

DIOPT Version :10

Sequence 1:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:162 Identity:27/162 - (16%)
Similarity:57/162 - (35%) Gaps:55/162 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KMMINSTKLFKNIFLDNRIQNAVS-----------NRTIYNI----------------------- 59
            ::..:.|....|:..::|.|:.|:           |||::|.                       
  Fly    19 RLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTNDVVIDYRFLKRENG 83

  Fly    60 -------KNLAICNFLNN--RLISKVYSVIYEGFVG-NSTVFRCPVQPSV----YYLSNSVREFE 110
                   ||:..|.||..  .:::|:..::::.|.. |.|   ||....:    .||...::...
  Fly    84 YKPWLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHT---CPFYGDILIRGMYLRTEIKAMP 145

  Fly   111 VPIFHQPGMFRLYVKLKAEKEGNMLTELIWRY 142
            .|    .|.:.|.:.....|:..::|.:.:.:
  Fly   146 YP----SGKYMLQINWSFYKKIQVVTNISYDF 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 19/117 (16%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 15/82 (18%)

Return to query results.
Submit another query.