DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33475 and CG33679

DIOPT Version :10

Sequence 1:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001027273.1 Gene:CG33679 / 3772494 FlyBaseID:FBgn0053679 Length:173 Species:Drosophila melanogaster


Alignment Length:75 Identity:17/75 - (22%)
Similarity:29/75 - (38%) Gaps:17/75 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CNFLN--NRLISKVYSVIYEGFVGNSTV-FRCPVQPSVYYLSNSVREFEVPIFHQPGMFRLYVKL 126
            |..|.  |||  :|:...|..|:..|.: ..||....:|..:.::.:            |::.|:
  Fly    90 CRVLRYPNRL--RVFYYFYTAFMPFSNINHTCPYNDDIYIRNCTLDD------------RMFAKV 140

  Fly   127 KAEKEGNMLT 136
            ...|....||
  Fly   141 PLPKGSYKLT 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 12/59 (20%)
CG33679NP_001027273.1 DUF1091 70..149 CDD:461928 15/72 (21%)

Return to query results.
Submit another query.