DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33475 and CG33773

DIOPT Version :10

Sequence 1:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster


Alignment Length:127 Identity:34/127 - (26%)
Similarity:52/127 - (40%) Gaps:20/127 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NRSNVDYFGLVPGESQKMMINSTKLFKNIFLDNRIQNAVSNRTIYNIKNLAICNFLNNRLISKVY 77
            |||    :..|.|:.:...|...::..|..:..|:..  ....:|||...| |.|:.|...:.|.
  Fly    51 NRS----YKYVSGKYKLNQIPLPRMKVNFIMWKRLNG--YRPFLYNITADA-CKFVENPKSNPVL 108

  Fly    78 SVIYEGFVGNSTV-FRCPVQPSVYYLSNSVREFEVPIFHQPGMFRLYV-KLKAEKEGNMLTE 137
            ..|::.|...|.: ..||      |.|:.:.| .:||    |...|.| ::....|||.|.|
  Fly   109 KYIFDSFSAYSNMNHSCP------YTSDLIVE-RLPI----GFMNLRVTEILPFPEGNYLFE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 19/70 (27%)
CG33773NP_001027213.1 DUF1091 73..158 CDD:461928 26/98 (27%)

Return to query results.
Submit another query.