DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33475 and CG33764

DIOPT Version :10

Sequence 1:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001027107.1 Gene:CG33764 / 3772289 FlyBaseID:FBgn0053764 Length:180 Species:Drosophila melanogaster


Alignment Length:64 Identity:15/64 - (23%)
Similarity:27/64 - (42%) Gaps:10/64 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ISKVYSVIY----------EGFVGNSTVFRCPVQPSVYYLSNSVREFEVPIFHQPGMFRLYVKL 126
            |:::|||:.          ..|....:.|...|..|..|:|..|:..::|:......|.||.::
  Fly    19 ITEIYSVVKFTNIQCQSLDRDFALFDSWFLKSVNRSYKYVSVKVKLLKIPVSKVKVRFGLYKRV 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 13/58 (22%)
CG33764NP_001027107.1 DUF1091 74..159 CDD:461928 3/9 (33%)

Return to query results.
Submit another query.