DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33475 and CG33775

DIOPT Version :10

Sequence 1:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster


Alignment Length:100 Identity:16/100 - (16%)
Similarity:42/100 - (42%) Gaps:29/100 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IYNIKNLAICNFLNNRLISKVYSVIYEGFV------GNSTVFRCP-----VQPSVYYLSNSVREF 109
            :||: :..:|..|.|     ..::.::|.|      |::....||     :..::.:..:.::..
  Fly    93 LYNV-STDLCQLLGN-----PNAISFQGLVINAIKKGSNLNHSCPYNHDIIVDNMEFSDDFLKTL 151

  Fly   110 EVPIFHQPGMFRLYVKLKAEKEGNMLTELIWRYRV 144
            .:|    .|::::.::....|        :||.:|
  Fly   152 PLP----QGVYKIQLRFATYK--------VWRVQV 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 12/76 (16%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:461928 12/76 (16%)

Return to query results.
Submit another query.