DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33475 and CG33643

DIOPT Version :10

Sequence 1:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:155 Identity:31/155 - (20%)
Similarity:56/155 - (36%) Gaps:57/155 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 STKLFKNIFLDN---RIQNAVSNRTIYNIKNLAICNFLNNRLISKVYS--------------VIY 81
            |||:|....::.   ::..: |||:..|      |:.|.||.:.|..:              .:|
  Fly    31 STKIFDTKTIETLGCQVDQS-SNRSYVN------CHMLLNREVGKFDARNVLDFVRPNGQEMKLY 88

  Fly    82 EG------FVGN----------STVFR------CPVQPSVYYLSNS--VREFEVPIFHQPGMFR- 121
            ||      .:|:          |..|:      ||::.:..|...:  :.|.:.|.|...|.|| 
  Fly    89 EGRLDACLLLGSIQKNRLVNIYSKTFKRFSNVECPLKANFNYTMKNLYMDEQDFPSFVPSGTFRS 153

  Fly   122 --------LYVKLKAEKEGNMLTEL 138
                    .::..:|...|.::..|
  Fly   154 LIEFYLNQTFIASRAIARGKVMPRL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 24/116 (21%)
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 13/72 (18%)

Return to query results.
Submit another query.