DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33475 and CG33689

DIOPT Version :10

Sequence 1:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:132 Identity:28/132 - (21%)
Similarity:52/132 - (39%) Gaps:35/132 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 INSTKLFKNIFLDNRIQNAVSNRTI--------YNIKNLAI------CNFLNNRL--ISKVYSVI 80
            :|.|..:.:::: |..:..:.|.||        :..|...|      |.||.|:.  |.|::..|
  Fly    46 VNRTHKYVDVYV-NLYKLPIDNITISFRLMRHDHGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKI 109

  Fly    81 YEGFVGNSTVFRCPVQPSV----YYLSNSVREF--EVPIFHQPGMFRLYVKLKAEKEGNMLTELI 139
            |:|  .::....||....:    .:..|...:|  .:|:.:  |.:.:|        .|..|:.|
  Fly   110 YQG--SSNINHTCPYDHDIIVDHLWTGNIESDFLKYIPMIN--GDYAVY--------SNWSTDNI 162

  Fly   140 WR 141
            .|
  Fly   163 MR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 20/91 (22%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:461928 17/83 (20%)

Return to query results.
Submit another query.