DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33475 and CG33689

DIOPT Version :9

Sequence 1:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:132 Identity:28/132 - (21%)
Similarity:52/132 - (39%) Gaps:35/132 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 INSTKLFKNIFLDNRIQNAVSNRTI--------YNIKNLAI------CNFLNNRL--ISKVYSVI 80
            :|.|..:.:::: |..:..:.|.||        :..|...|      |.||.|:.  |.|::..|
  Fly    46 VNRTHKYVDVYV-NLYKLPIDNITISFRLMRHDHGYKPFFIDYTFDGCKFLRNQKHPIIKLFYKI 109

  Fly    81 YEGFVGNSTVFRCPVQPSV----YYLSNSVREF--EVPIFHQPGMFRLYVKLKAEKEGNMLTELI 139
            |:|  .::....||....:    .:..|...:|  .:|:.:  |.:.:|        .|..|:.|
  Fly   110 YQG--SSNINHTCPYDHDIIVDHLWTGNIESDFLKYIPMIN--GDYAVY--------SNWSTDNI 162

  Fly   140 WR 141
            .|
  Fly   163 MR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33475NP_995799.1 DUF1091 54..122 CDD:284008 19/89 (21%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.