DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33475 and CG33476

DIOPT Version :9

Sequence 1:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:147 Identity:41/147 - (27%)
Similarity:73/147 - (49%) Gaps:1/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KAVCLGLELKYNRSNVDYFGLVPGESQKMMINSTKLFKNIFLDNRIQNAVSNRTIYNIKNLAICN 66
            |.:...|....:.:.|:||...|...........||.|...:|..::...:.|.:|.:.|...|.
  Fly    18 KFIMESLATSCDHNFVEYFHKAPDMVDIYTFRVVKLAKAFTIDFAVRVVKTKRVMYKVDNFDGCQ 82

  Fly    67 FLNNRLISKVYSVIYEGFVGNSTVFRCPVQPSVYYLSNSVREFEVPIFHQPGMFRLYVKLK-AEK 130
            ||.|.|:::|:..:|:..|.|.:.|.||::|.|||:.|......:|:|..||.:::.:::: .|.
  Fly    83 FLMNPLMNRVFGTVYKRLVVNGSFFSCPIKPGVYYIRNEGSVAMLPVFQPPGRYQITMRVRMRES 147

  Fly   131 EGNMLTELIWRYRVRRI 147
            ....:.|::|.|.|.||
  Fly   148 RDPFVMEMLWVYSVVRI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33475NP_995799.1 DUF1091 54..122 CDD:284008 24/67 (36%)
CG33476NP_995798.2 DUF1091 57..138 CDD:284008 25/80 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449923
Domainoid 1 1.000 45 1.000 Domainoid score I19322
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014251
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.