DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk25 and ASIC5

DIOPT Version :9

Sequence 1:NP_995766.1 Gene:ppk25 / 2768722 FlyBaseID:FBgn0053349 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_059115.1 Gene:ASIC5 / 51802 HGNCID:17537 Length:505 Species:Homo sapiens


Alignment Length:475 Identity:90/475 - (18%)
Similarity:174/475 - (36%) Gaps:98/475 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SSIHGMPYIARRDLHWAERLFWTFIILGS---AYYAISSCLNQWYRFRDNPIVYEYEYLFGLRIF 82
            :|.||:..|. ::.....|:.|..::|||   ..:.|...|..::.:.....: |.:|:..:.  
Human    45 TSFHGIHNIV-QNRSKIRRVLWLVVVLGSVSLVTWQIYIRLLNYFTWPTTTSI-EVQYVEKME-- 105

  Fly    83 PFVGITLCPRYHDETEIPR---LINQTWGVDPSEDKEKAVYYRKFLLAINGLRYSTLETLEPFEN 144
             |..:|.|.....:|:...   :|...|.:     ..|.::.::......|.|.:| :.....:|
Human   106 -FPAVTFCNLNRFQTDAVAKFGVIFFLWHI-----VSKVLHLQEITANSTGSREAT-DFAASHQN 163

  Fly   145 DTTLDNVN----YLNILLTLQKKVIAVKI-PPELAPIITEVGLC---------QTSSQLNRYGNP 195
            .:.::.:.    |||....|..:...... |.:.|.:.||.|.|         |...:::..|..
Human   164 FSIVEFIRNKGFYLNNSTLLDCEFFGKPCSPKDFAHVFTEYGNCFTFNHGETLQAKRKVSVSGRG 228

  Fly   196 YGKLETQDMEPMKQCGYLSNCITSLKPINSIVAPIFMYLHDVEEMMLPDDMRTPSFDAKDIESKD 260
            ...|...:.|          ..|....:..:.|.|...:|..:        :.|.||...:.|  
Human   229 LSLLFNVNQE----------AFTDNPALGFVDAGIIFVIHSPK--------KVPQFDGLGLLS-- 273

  Fly   261 LDIMLHTTSAESEVRNLPVAYRKCRFSDEN---NLQYYSPYHPSLCRLECRIKWALSLCNCKP-- 320
             .:.:|   |...:|.:...:::..:.:.|   .||.:|.|..|.|..||:.:.....|.|.|  
Human   274 -PVGMH---ARVTIRQVKTVHQEYPWGECNPNIKLQNFSSYSTSGCLKECKAQHIKKQCGCVPFL 334

  Fly   321 ------------YFYVAAPEV------PICTVS--GMLCLARSKWLERPC----DCYPSCREETF 361
                        ||...:|.:      .:|||.  ...|....:.:|.|.    ..:||.:...:
Human   335 LPGYGIECDLQKYFSCVSPVLDHIEFKDLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKY 399

  Fly   362 TIFKVSDQTGGDDNYSGERFERTLIINLQISRMGINRRV-----VFSTDQLIMSFGGAIGLFLGA 421
            ...|::         ...::.|..::.::|:...:|.::     ..|..:|:...||.:|||.||
Human   400 LSKKLN---------QSRKYIRENLVKIEINYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGA 455

  Fly   422 SFMTIYGVVYFFLTFIAYTC 441
            |.:||..::.:..|...:.|
Human   456 SLITIIEIIEYLFTNFYWIC 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk25NP_995766.1 ASC 18..432 CDD:279230 88/464 (19%)
ASIC5NP_059115.1 ASC 41..466 CDD:279230 88/464 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.