DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk25 and scnn1a

DIOPT Version :10

Sequence 1:NP_995766.1 Gene:ppk25 / 2768722 FlyBaseID:FBgn0053349 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001184124.1 Gene:scnn1a / 395013 XenbaseID:XB-GENE-996083 Length:633 Species:Xenopus tropicalis


Alignment Length:83 Identity:23/83 - (27%)
Similarity:34/83 - (40%) Gaps:23/83 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 CSIKFHIHLPYERCYARRVQRVYDPPDV-VGYFEMCVWPLYEKHYREFKGRKDIYVLNGEIAPD- 251
            |.|||   |.::.|         ||.:| ..|:..|...:.....|.|   ||.|::|...||: 
 Frog   123 CEIKF---LTFKDC---------DPGEVNKAYWRSCAMMMGCVIERAF---KDEYMVNLVRAPEV 172

  Fly   252 ------SIFNYVLNSIKD 263
                  ..::.||:|..|
 Frog   173 PVISGAFCYDVVLDSKLD 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk25NP_995766.1 ASC 18..432 CDD:459966 23/83 (28%)
scnn1aNP_001184124.1 ENaC 18..602 CDD:273304 23/83 (28%)

Return to query results.
Submit another query.