DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk25 and ppk29

DIOPT Version :9

Sequence 1:NP_995766.1 Gene:ppk25 / 2768722 FlyBaseID:FBgn0053349 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster


Alignment Length:432 Identity:92/432 - (21%)
Similarity:170/432 - (39%) Gaps:74/432 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LFWTFIILGSAYYAIS--SCLNQWYRFRDNPIVYEYEYLFGLRIFPFVGITLCPRYHDETEIPRL 102
            |.|.|:|..|.:..:|  ..|...|......|.....|...:..||.:||.| .:.....|...:
  Fly    22 LLWIFVIGISGWSTVSILVLLKTRYETDSTTIGVSTAYSRWINTFPSIGICL-TKSRAFNEFKAM 85

  Fly   103 INQTWGVDPSEDKEKAVYYRKFLLAINGLRYSTLETLEPFENDTTLDNVNYLNILLTLQKKVIAV 167
            :.:.:..|.:....:.:|...||...|      :.|.||.:|.:...|.|.|:|    ::|:...
  Fly    86 MREYFQEDFAFSFTRMIYEYAFLNPNN------IFTKEPTKNTSYPYNFNILDI----RRKMFPT 140

  Fly   168 KIPPELAPI-----------------ITEVGLCQTSSQLNRYGNPYGKLETQDMEPMKQCGYLSN 215
            ........|                 :||:|.|..::.|..|.:      .::| |::.....:|
  Fly   141 NCTECFKEIYFRGELVTDCEEIFKFHVTEMGYCFLANNLLDYDS------IEEM-PLRYSSLDNN 198

  Fly   216 CITSLKPINSIVAPIFMYLHDVEEM--------MLPDDMRTPSFDAKDIESKDLDIMLHTTSAES 272
            ....|...:|::....||::..|::        .:..|..|.:|:.::|.:.:            
  Fly   199 RSLRLYMRSSVMYKYEMYVNSPEDLPFFNSLTYTISTDPTTYAFNVEEIHNHE------------ 251

  Fly   273 EVRNLPVAYRKCRFSDENNLQYYSPYHPSLCRLECRIKWALSLCNCKPYFYVAAPEVPICTVSGM 337
            .|.:.|::.|||:|..|::::.: ||..|.|....|.::.:..|:|..:......|...|.:...
  Fly   252 GVIDEPISQRKCKFPSESSIEGF-PYSFSACMSIIRSEFEMKTCDCSLFNPKDRNESLYCGLQHA 315

  Fly   338 LCLARSKWLERPCD-------CYPSCREETFTIFKVSDQTGGDDNYSGERFERTLIINLQIS--- 392
            .||.:..:..|..:       |.|||.|:..::..|..:.|...|      ..|.|..:||:   
  Fly   316 DCLIKEGFATRVKEYVGSSTVCLPSCVEQQISLVGVITENGTLYN------NNTQITEIQIASPP 374

  Fly   393 RMGINRRVVFSTDQLIMSFGGAIGLFLGASFMTIYGVVYFFL 434
            .:...|:|..:...||:..|...|||.|||.:.:..::.:|:
  Fly   375 TVRYERKVTQTKLDLIVGIGSVAGLFFGASLLNLLEIISYFI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk25NP_995766.1 ASC 18..432 CDD:279230 91/428 (21%)
ppk29NP_001097442.2 ASC 123..415 CDD:279230 66/321 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.