DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk25 and Gr59e

DIOPT Version :9

Sequence 1:NP_995766.1 Gene:ppk25 / 2768722 FlyBaseID:FBgn0053349 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:250 Identity:42/250 - (16%)
Similarity:85/250 - (34%) Gaps:88/250 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MSRPKQPDWLAELCQESS--------------IHGMPYIAR--RDLHWAERL-FWTFIILGSAYY 52
            :.||.|.....:.|.||:              |..|.|...  ..:|....| |..:::|.....
  Fly   195 LQRPPQGSTKLDACYESAFAVLVDAGGGSALMIEEMRYTCNLIEQVHSQFLLRFGLYLVLNLLNS 259

  Fly    53 AISSCLNQW--YRFRDNPIVYEYEYLFGLRIFPFVGITLCPRYHDETEIPRLINQTWGVDPSEDK 115
            .:|.|:..:  :.|.:.|:                                     |      ::
  Fly   260 LVSICVELYLIFNFFETPL-------------------------------------W------EE 281

  Fly   116 EKAVYYRKFLLAINGLRYSTLETLEPFENDTTLDNVNYLNILLTLQKKVIAVKIPPELAPIITEV 180
            ...:.||...||::|.|                     :..:|::.::::..|.  .|..::.|:
  Fly   282 SVLLVYRLLWLAMHGGR---------------------IWFILSVNEQILEQKC--NLCQLLNEL 323

  Fly   181 GLCQTSSQLNRYGNPY-GKLETQDMEPMKQCGYLSNCITSLKPINSIVAPIFMYL 234
            .:|  ||:|.|..|.: .:|:....:|::.||.::....||.....::..|.::|
  Fly   324 EVC--SSRLQRTINRFLLQLQRSIDQPLEACGIVTLDTRSLGGFIGVLMAIVIFL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk25NP_995766.1 ASC 18..432 CDD:279230 38/236 (16%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 41/249 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.