DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk25 and egas-3

DIOPT Version :9

Sequence 1:NP_995766.1 Gene:ppk25 / 2768722 FlyBaseID:FBgn0053349 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_507638.2 Gene:egas-3 / 190557 WormBaseID:WBGene00013480 Length:921 Species:Caenorhabditis elegans


Alignment Length:438 Identity:84/438 - (19%)
Similarity:149/438 - (34%) Gaps:116/438 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ITLCPRYHDETEIPRLINQTWG--VDPSEDKEKAVYYRKFLLAINGLRYSTLETLEPFENDTTLD 149
            |.||..|.|        |:.|.  ..|...|:......|   .|||...|..|..    .||..|
 Worm   514 IDLCVPYWD--------NEAWKWIKSPCNSKDDMANCTK---KINGFTCSCGEKW----TDTLCD 563

  Fly   150 -NVNYLNILLTLQKKVIAVKIP------------PELAPIITEVGLCQTSSQLNRYGNPYGKL-- 199
             ||...::|:.:...|....|.            .::.|.||  ||. |.|:.:......|.|  
 Worm   564 LNVLIKDVLMAIYGHVDLTMITLLNDLMQNPSQIKDMVPFIT--GLL-TDSERSDLSWDAGDLFN 625

  Fly   200 ----ETQDMEPMKQCG-----YLSNCIT-----------------------SLKPINSIVAP--- 229
                |.|.::..:...     .|.||.|                       .:|......||   
 Worm   626 WIAFEDQRLDLNRDIHKWNDVVLGNCFTFNHRDRNFTYLMRRPGRHGGIQAFMKTRQDEYAPWYD 690

  Fly   230 ---IFMYLHDVEEMMLPDDMRTPSFDAKDIESKDLDIMLHTTSAESEVRNLPVAYRKC--RFSDE 289
               |.:::|:.::.:..:.:|   ::|:......::|.:      :....|...|.||  :.|:.
 Worm   691 TAAINVFIHNRDDYVFSESVR---YNAQPNAQSTINIFM------TRYTRLGGNYGKCIKKPSEV 746

  Fly   290 NNLQYYSPYHPSLCRLEC---RIKWALSLCNCKPYFYVAAPEVPICTVSGMLCLAR--------S 343
            .|..|...|....|...|   |:|   ..|||....|..||....|.:|...|:..        |
 Worm   747 KNYYYPGAYTTDGCLRTCYQDRMK---EECNCMDPRYPQAPNSTSCQLSERSCVTEASEAAGDPS 808

  Fly   344 KWLERPCDCYPSCREETFTI---------FKVSDQTGGDDNYSGERFERTLIINLQISRMGINRR 399
            .|  ..|.|...|..:.:::         ..::.:...|.....::::..|::::.:.::..  :
 Worm   809 TW--SSCVCPLPCSNQEYSVTWSKANFVNLPITCEKSSDVATCQKQYKDQLMVSIILPQLDF--K 869

  Fly   400 VVFST-----DQLIMSFGGAIGLFLGASFMTIYGVVYFFLTFIAYTCK 442
            :...|     ::.:...||.:|:.:|.:.:|...||:.|.......|:
 Worm   870 IYAETPAMDFNKFLSQLGGQLGVLMGINVVTFIEVVFLFFGMFMVLCQ 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk25NP_995766.1 ASC 18..432 CDD:279230 82/426 (19%)
egas-3NP_507638.2 ASC <649..907 CDD:279230 47/273 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.