DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk25 and del-5

DIOPT Version :9

Sequence 1:NP_995766.1 Gene:ppk25 / 2768722 FlyBaseID:FBgn0053349 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_509838.2 Gene:del-5 / 186631 WormBaseID:WBGene00010334 Length:526 Species:Caenorhabditis elegans


Alignment Length:256 Identity:49/256 - (19%)
Similarity:101/256 - (39%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 YLSNCITSLKPINSIVAPIFMYLHDVEEMMLPDDMRTPS----------FDAKDIESKDLDI--- 263
            |:..|.|.:|..::  .|.||.:::.:.....:::...|          .:.|.:..|::|.   
 Worm   101 YIMVCGTMIKTYST--QPSFMRINETKSHRAENNIELCSEKQLTCNEILKENKQMTCKEVDAYCV 163

  Fly   264 -MLHTTSAESEVRNLPVAYRKCRFSDENNLQYYS--PYHPSLCRLEC----RIKWALSLC--NCK 319
             :..:|..:..::...:.:   :...|.::.|.|  |:...:.||:.    |:....:.|  |.:
 Worm   164 SIRFSTKTKIRLKKKGLYF---KHGTEEDVHYLSSKPHTHHMIRLKLIQIDRLNLGRAPCTTNWR 225

  Fly   320 PYFYVAAPEVPICTVSGMLC------LARS-KWLERPCDCYPSCREETFTIFKVSDQTGGDDNYS 377
            ...::....:|....|..:|      |.|. ::|:....|||||.|..:.:.|      ....:|
 Worm   226 EITWIEKDSIPDYRYSLNMCENIRFELTRKVEYLQYDFPCYPSCSEIKYQVSK------SKLRHS 284

  Fly   378 GERFERTLIINLQISRMGINRRVVFSTDQLIMSFGGAIGLFLGASFMTIYGVVYFFLTFIA 438
            .:....|..:...|:.|...|:....  .::...|||..||:|.|.:|:..:..|....:|
 Worm   285 SDSVVITFSVLPTITLMQETRKTTLI--DILCYLGGASSLFMGCSCVTLMEMFVFLFKLVA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk25NP_995766.1 ASC 18..432 CDD:279230 47/248 (19%)
del-5NP_509838.2 ASC 66..337 CDD:295594 47/248 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.