DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk25 and degt-1

DIOPT Version :9

Sequence 1:NP_995766.1 Gene:ppk25 / 2768722 FlyBaseID:FBgn0053349 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_505703.3 Gene:degt-1 / 184921 WormBaseID:WBGene00009109 Length:852 Species:Caenorhabditis elegans


Alignment Length:344 Identity:70/344 - (20%)
Similarity:116/344 - (33%) Gaps:102/344 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LAELCQESSIHGMPYIARRDLHWAERLFWTFII---LGSAYYAISSCLNQWYRFRDNPIV--YEY 73
            |....:::|:.|..|:..|...|. |:.|.|::   :|..:|.:...:.  |.|..||:.  ..|
 Worm    41 LDRFAEDTSMLGFRYLHTRYKTWF-RVLWGFVVVFFIGLTFYQVFERVT--YYFIKNPLTTRRSY 102

  Fly    74 EYLFGLRIFPFVGITLCPRYHDE-----TEIPRLINQTWGV-DPSEDKEKAVYYRKFLLAINGLR 132
            |.|..: .||.:|:  |.:...:     ::.|.|:.....| |.|..              |..|
 Worm   103 ETLPNM-YFPTIGV--CNKMQIKASSVASKNPDLLRGMCSVLDESSS--------------NSSR 150

  Fly   133 YSTLETLEPFENDTTLDNVN----YLNILLTLQKKVIAVKI------PPELAPIITEVGLCQTSS 187
            :..|:         ..|:|:    |.|...:.....::.:.      ..|:.||.|..|||.:.|
 Worm   151 FDELD---------KFDDVDILSLYRNSFQSADDLFVSCEFGKSGSCQDEIRPIYTPFGLCYSVS 206

  Fly   188 QLNRYGNPYGKLETQDMEPMKQCGYLSNCITSLKPINSIVAPIFMYLHDVEEMMLPDDMRTPS-- 250
                              |.|         |.|:|.......:.:.| :|.| ::|..:..|.  
 Worm   207 ------------------PNK---------TILRPGPETTLSLVLNL-EVHE-IIPGTVVEPGVV 242

  Fly   251 ---FD-AKDIESKDLDIMLH----TTSAESEVRNLPVAYRKC------RFSDENNLQYYSPYHPS 301
               :| |..:......|.|.    .|...:|||.|.:....|      .||::.       |..:
 Worm   243 LSIYDGASSLSHYSEGIHLEAGKVVTIPVNEVRKLRLHESSCGSTKMESFSEKE-------YSKA 300

  Fly   302 LCRLECRIKWALSLCNCKP 320
            .|.....:|.....|.|.|
 Worm   301 ACEWSVSVKQIEKECGCIP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk25NP_995766.1 ASC 18..432 CDD:279230 69/340 (20%)
degt-1NP_505703.3 ASC 44..>318 CDD:279230 67/338 (20%)
ASC <704..836 CDD:295594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.