DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk25 and egas-1

DIOPT Version :9

Sequence 1:NP_995766.1 Gene:ppk25 / 2768722 FlyBaseID:FBgn0053349 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001359624.1 Gene:egas-1 / 180219 WormBaseID:WBGene00013486 Length:922 Species:Caenorhabditis elegans


Alignment Length:444 Identity:94/444 - (21%)
Similarity:152/444 - (34%) Gaps:119/444 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ITLCPRYHDETEIPRLINQTWGVDPSEDKEKAVYYRKFLLAINGLRYS-------TLETLEPFEN 144
            |.||..|.|.|       ..|...|...|:......|   .||.|..|       ||..|.....
 Worm   515 IDLCVPYKDST-------GKWIKTPCNSKDDMANCTK---GINTLTCSCGDKWTDTLCDLNILIK 569

  Fly   145 DTTLDNVNY-----LNILLTLQKKVIAVKIPPELAPIITEVGLCQTSSQLNRYGNPYGKL----- 199
            |..:....|     :::|..|.:....:|   ::.|.||  ||. |.|:.:......|.|     
 Worm   570 DVLMAIYGYVDLTMISLLNDLMQNPSQIK---DMVPFIT--GLL-TDSERSDLSWDAGDLFNWIA 628

  Fly   200 -ETQDMEPMKQCG-----YLSNCIT-----------------------SLKPINSIVAP------ 229
             |.|.::..:...     .|.||.|                       .:|......||      
 Worm   629 FEDQRLDLNRDIHKWNDVVLGNCFTFNHRDRNFTYRLRSSGRHGGIQAFMKTRQDEYAPWYDTAA 693

  Fly   230 IFMYLHDVEEMMLPDDMRTPSFDAKDIESKDLDIMLHTTSAESEVRNLPVAYRKC--RFSDENNL 292
            |.:::|:.::.:..:.:|   ::|:......::|.:      :....|...|.||  :.|:..|.
 Worm   694 INVFIHNRDDYVFSESVR---YNAQPNAQSTMNIFM------TRYTRLGGRYGKCVKKPSEVKNY 749

  Fly   293 QYYSPYHPSLCRLEC---RIKWALSLCNCKPYFYVAAP-EVPICTVSGMLCLA--------RSKW 345
            .|...|....|...|   |:|   ..|||....|..|| .|..|.:|...|:.        .|||
 Worm   750 YYPGAYTTDGCLRTCYQDRMK---QECNCMDPRYPQAPGNVTSCQLSERSCVTVASEAAGDPSKW 811

  Fly   346 LERPCDCYPSCREETFTIF--------------KVSDQTGGDDNYSGERFERTLIINLQISRMGI 396
            .:  |.|...|..:.:::.              |.||.:....:|..:.....::..|.......
 Worm   812 WD--CVCPLPCSNQEYSVTWSKANFVNLPIICGKSSDVSTCKAHYIDQLMVSIVLPQLDFKIYAE 874

  Fly   397 NRRVVFSTDQLIMSFGGAIGLFLGASFMTIYGVVYFFLTFIAYT-CKNRFCKRF 449
            |..:.|  ::.:...||.:|:.:|.:.:|...||  ||.|..:| |    ||::
 Worm   875 NPAMDF--NKFLSQLGGQLGVLMGINLVTFIEVV--FLLFGLFTLC----CKKY 920

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk25NP_995766.1 ASC 18..432 CDD:279230 87/424 (21%)
egas-1NP_001359624.1 deg-1 <595..908 CDD:273309 66/336 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.