DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk25 and del-6

DIOPT Version :9

Sequence 1:NP_995766.1 Gene:ppk25 / 2768722 FlyBaseID:FBgn0053349 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_741622.2 Gene:del-6 / 179474 WormBaseID:WBGene00011891 Length:577 Species:Caenorhabditis elegans


Alignment Length:281 Identity:55/281 - (19%)
Similarity:101/281 - (35%) Gaps:88/281 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SQLNRYGNPYGKLETQDMEPMKQCGYLSN-CITSLKPINSIVAPIFMYLHDVEEMMLPDDMRTPS 250
            |.|||:..  ||..::|       ||:.. |:.....:.:.|..::       :|:..|:..|..
 Worm   290 SSLNRFME--GKGRSRD-------GYVDEVCLGQRHEVTAHVTALY-------QMLENDEQGTRC 338

  Fly   251 FDAKDIESKDLDIMLHTTSAESEVRNLPVAYRKCRFSDENNLQYYSPYHPSLCRLECRIKWALSL 315
            .|.:|.|..:.:                                        ||..||::.....
 Worm   339 RDVEDGEDSEFN----------------------------------------CRSRCRMEMIRDA 363

  Fly   316 CNCKP--YFYVAAPE----VPI-----CTVSGMLCLARSKWLERPC--DCYPSCREETFTIFKVS 367
            |:|.|  ..|:|..|    .|:     |||.    :.:..:.:..|  .|:|.||:..|.:    
 Worm   364 CHCTPLSLSYLAKKEDMEIFPLCDYTQCTVD----VQKGNYSDTECANKCFPDCRQIRFEV---- 420

  Fly   368 DQTGGDDNYSGERFERTL-IINLQ---ISRMGINRRVVFSTDQLIMSFGGAIGLFLGASFMTIYG 428
                 |.:..|......| ::.|.   ...:.:.::..:|....|.:.||:||::||.|.:::..
 Worm   421 -----DHSVKGRMLRPDLTLVELSWGPFEYLTMEQQWKYSATSFIAALGGSIGMWLGLSILSLIQ 480

  Fly   429 VVYFFLTFIAYTCKN-RFCKR 448
            :|.:..|:......| |..|:
 Worm   481 LVTYSYTYFTKKIVNERILKK 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk25NP_995766.1 ASC 18..432 CDD:279230 51/262 (19%)
del-6NP_741622.2 ASC <347..484 CDD:295594 34/189 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.