DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp12d1-d and CYP712A2

DIOPT Version :9

Sequence 1:NP_995812.1 Gene:Cyp12d1-d / 2768720 FlyBaseID:FBgn0053503 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_680150.1 Gene:CYP712A2 / 830581 AraportID:AT5G06905 Length:521 Species:Arabidopsis thaliana


Alignment Length:439 Identity:105/439 - (23%)
Similarity:186/439 - (42%) Gaps:117/439 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 GEVQGLVASQNEAWGKLRSAINPIFMQ-----PRGLRMYYEPLSNINNEF--------------- 179
            |.::.||.|.::....:....:|.|..     ||...:|.      .:||               
plant    71 GSLRVLVVSDSDTAKLILKTHDPDFASKFVFGPRQFNVYK------GSEFFNAPYGSYWRFMKKL 129

  Fly   180 ----------IERIKEIRDPKTLEVPEDFTDEISRLVFESLGLVAFD-------------RQMGL 221
                      ::|..:||:.:||.:       :|.||..|....|.|             .:|.:
plant   130 CMTKLFAGYQLDRFVDIREEETLAL-------LSTLVERSRNGEACDLGLEFTALTTKILSKMVM 187

  Fly   222 IRKNRDNSDA--------------------LTLFQTSRDIFRLTFKLDIQPSMWKIISTPTYRKM 266
            .::.|.||:.                    :.||...||:........::.|:|:.         
plant   188 GKRCRQNSNIPKEIRKIVSDIMACATRFGFMELFGPLRDLDLFGNGKKLRSSIWRY--------- 243

  Fly   267 KRTLNDSLNVSQKMLKENQDALEKRRQAGEKINSNSMLERLMEI--DPKVAVIMS--------LD 321
                 |.|  .:|:|||.::  :|..:..||  ...:::.|::.  |||..:.::        |:
plant   244 -----DEL--VEKILKEYEN--DKSNEEEEK--DKDIVDILLDTYNDPKAELRLTMNQIKFFILE 297

  Fly   322 ILFAGVDATATLLSAVLLCLSKHPDKQAKLREELLSIMPTKDSLLNEENMKDMPYLRAVIKETLR 386
            :..|.:|.|:..|...:..|..|||..||:|:|:.|::.|.:.|:.|.:::.:|||:|.||||||
plant   298 LFMASLDTTSAALQWTMTELINHPDIFAKIRDEIKSVVGTTNRLIKESDLQKLPYLQAAIKETLR 362

  Fly   387 YYPNGFGTMRTCQNDVILSGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWL-RDPETGKKM 450
            .:|.|....|....|:.::||.|..||.:.:.:..:|::.|.|..||:|:|||:| .:.:|.:||
plant   363 LHPVGPLLRRESNTDMKINGYDVKSGTKIFINAYGIMRDPTTYKDPDKFMPERFLVVEQDTERKM 427

  Fly   451 ----------QVSPFTFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFH 489
                      :.....:|.||.|.|.|:|.....|.:..|:..|::.|:
plant   428 GYYQQYMLELKGQDVNYLAFGSGRRGCLGASHASLVLSLTIGSLVQCFN 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp12d1-dNP_995812.1 p450 70..508 CDD:299894 105/439 (24%)
CYP712A2NP_680150.1 p450 6..482 CDD:299894 105/439 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.