DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and KLF16

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_114124.1 Gene:KLF16 / 83855 HGNCID:16857 Length:252 Species:Homo sapiens


Alignment Length:246 Identity:82/246 - (33%)
Similarity:116/246 - (47%) Gaps:55/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 LSISPQALGHSNIGSNSPKSSSSSSSNSSNSSSSSHSSSSSISGSSDQPTHSNIPRSTIVRLTTA 390
            ::||..|:.|.  |...|:.:..::..... ::...::|....|....|..::.|          
Human    17 MAISSGAVVHR--GRPGPEGAGPAAGLDVR-AARREAASPGTPGPPPPPPAASGP---------- 68

  Fly   391 NGKPGAAGIS--LARVIQMQNNGNANVAAVLSAAANSGSSNSNSNSSSSNTSSNSINTATPQQQV 453
              .||||...  ||..|.....|.       ..||..|:|.::|:|::|:.||.           
Human    69 --GPGAAAAPHLLAASILADLRGG-------PGAAPGGASPASSSSAASSPSSG----------- 113

  Fly   454 LSQRSEKSANGSSKPHHPRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYK 518
                   .|.|:             :|.|..:.|:|.|..|.|.|.||||||:|.||||||:|:.
Human   114 -------RAPGA-------------APSAAAKSHRCPFPDCAKAYYKSSHLKSHLRTHTGERPFA 158

  Fly   519 CSWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRH 569
            |.|:||:.:|||||||.||:|.|||.|.|.|..|.:.|:||||||.|.:||
Human   159 CDWQGCDKKFARSDELARHHRTHTGEKRFSCPLCSKRFTRSDHLAKHARRH 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 46/103 (45%)
C2H2 Zn finger 489..511 CDD:275368 13/21 (62%)
zf-H2C2_2 503..>519 CDD:290200 11/15 (73%)
C2H2 Zn finger 519..541 CDD:275368 14/21 (67%)
zf-H2C2_2 533..558 CDD:290200 13/24 (54%)
C2H2 Zn finger 549..569 CDD:275368 10/19 (53%)
KLF16NP_114124.1 KLF16_N 2..>88 CDD:409237 17/85 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..74 10/63 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..128 13/75 (17%)
COG5048 125..>189 CDD:227381 39/63 (62%)
C2H2 Zn finger 132..151 CDD:275368 11/18 (61%)
C2H2 Zn finger 159..181 CDD:275368 14/21 (67%)
zf-C2H2 187..209 CDD:395048 11/21 (52%)
C2H2 Zn finger 189..209 CDD:275368 10/19 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..252 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.