DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and zgc:153115

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001070797.2 Gene:zgc:153115 / 768186 ZFINID:ZDB-GENE-061013-418 Length:250 Species:Danio rerio


Alignment Length:216 Identity:81/216 - (37%)
Similarity:107/216 - (49%) Gaps:36/216 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 ISGSSDQPTHSNIPRSTIVRLTTANGKPGAAG--ISLARVIQMQNNGNANVAAVLS--------A 421
            :||::..|. ..:|.          |:|..:.  ..:...:::.......||.:|:        .
Zfish    29 VSGAAQAPP-QGLPA----------GEPDGSSEDREVRETLRLDGANMMTVAEILTDLHGKFRPM 82

  Fly   422 AANSGSSNSNSNSSSSNTSSNSIN---TATPQQQVLSQRSEKSANGSSKPHHPRQHHSDHSPDAK 483
            :|.|.||||:...|...|.|:|..   |.||....:..:|::...|...|..|          .|
Zfish    83 SAYSESSNSSCGESGYTTLSDSTTPTPTMTPSATPVPGQSQQIWGGGGAPRSP----------TK 137

  Fly   484 RRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFK 548
            |  |.|.|.||.:||.||||||||.||||||:|:.|:|..||.:|||||||.||.|.|||.|.|.
Zfish   138 R--HPCTFDGCDRVYGKSSHLKAHIRTHTGERPFPCTWPECEKKFARSDELARHLRTHTGEKRFL 200

  Fly   549 CRNCDRCFSRSDHLALHMKRH 569
            |..||:.|.|||||..|.:||
Zfish   201 CPLCDKRFMRSDHLIKHARRH 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 51/103 (50%)
C2H2 Zn finger 489..511 CDD:275368 15/21 (71%)
zf-H2C2_2 503..>519 CDD:290200 12/15 (80%)
C2H2 Zn finger 519..541 CDD:275368 14/21 (67%)
zf-H2C2_2 533..558 CDD:290200 14/24 (58%)
C2H2 Zn finger 549..569 CDD:275368 10/19 (53%)
zgc:153115NP_001070797.2 C2H2 Zn finger 144..163 CDD:275368 13/18 (72%)
COG5048 153..>201 CDD:227381 33/47 (70%)
zf-H2C2_2 155..182 CDD:290200 17/26 (65%)
C2H2 Zn finger 171..193 CDD:275368 14/21 (67%)
zf-H2C2_2 185..208 CDD:290200 13/22 (59%)
zf-C2H2 199..221 CDD:278523 11/21 (52%)
C2H2 Zn finger 201..221 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.