DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and klf13

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001070240.1 Gene:klf13 / 767805 ZFINID:ZDB-GENE-060929-1274 Length:258 Species:Danio rerio


Alignment Length:245 Identity:82/245 - (33%)
Similarity:113/245 - (46%) Gaps:48/245 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 LSISPQALGHSNIGSNSPKSSSSSSSNSSNSSSSSHSSSSSISGSSDQPTHSNIPRSTIVRLTTA 390
            :|:|.||:.|...|:...|..::::..:...:......:||:                       
Zfish    10 VSMSSQAIVHGPKGNRETKPETAAAQRNGEEAKEPLKDNSSL----------------------- 51

  Fly   391 NGKPGAAGISLARVIQMQNNGNANVAAVLSAAANSGSSNSNSNSSSSNTSSNSIN-TATPQQQVL 454
                    ..:||::.   :.|....|..:..|.....::...::.|....||.. ||.|....|
Zfish    52 --------FVVARILA---DFNQQTPASFAEQAKIKEESTPPTATPSGDDGNSATPTAIPGDSAL 105

  Fly   455 SQRSEKSANGSSKPHHPRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKC 519
            .||        .|....|..|     ||.::.|||.:.||:|||.||||||||.||||||:|:.|
Zfish   106 KQR--------GKRFRGRVEH-----DAPQKKHKCHYSGCEKVYGKSSHLKAHLRTHTGERPFPC 157

  Fly   520 SWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRH 569
            :|..|..:|||||||.||||.|||.|.|.|..||:.|.|||||..|.:||
Zfish   158 TWPDCSKKFARSDELARHYRTHTGEKKFGCPLCDKRFMRSDHLMKHARRH 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 53/103 (51%)
C2H2 Zn finger 489..511 CDD:275368 15/21 (71%)
zf-H2C2_2 503..>519 CDD:290200 12/15 (80%)
C2H2 Zn finger 519..541 CDD:275368 14/21 (67%)
zf-H2C2_2 533..558 CDD:290200 15/24 (63%)
C2H2 Zn finger 549..569 CDD:275368 10/19 (53%)
klf13NP_001070240.1 zf-C2H2_8 127..209 CDD:292531 52/81 (64%)
C2H2 Zn finger 127..149 CDD:275368 15/21 (71%)
zf-H2C2_2 141..168 CDD:290200 16/26 (62%)
C2H2 Zn finger 157..179 CDD:275368 14/21 (67%)
zf-H2C2_2 171..194 CDD:290200 14/22 (64%)
C2H2 Zn finger 187..207 CDD:275368 10/19 (53%)
zf-C2H2 187..207 CDD:278523 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.