DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and Klf14

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001128565.1 Gene:Klf14 / 619665 MGIID:3577024 Length:325 Species:Mus musculus


Alignment Length:284 Identity:87/284 - (30%)
Similarity:123/284 - (43%) Gaps:63/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 LSISPQALGHSNIGSNSPKSSSSSSSNSSNSSSSSHSSSSSISGSSDQ---PTHSNIPRSTIVRL 387
            :|:|.:|:.|..  :..|:.:|:::  .|...:.|..|:...:||...   |....:|       
Mouse    17 VSMSTRAVLHRR--ATDPEGASAAA--VSEVGAVSRESAGKGTGSRGVLWIPPVLQVP------- 70

  Fly   388 TTANGKPGAAGISLARVIQMQNNGNANVAAVLSAAANSGSSNSNSNSSSSNTS-------SNSIN 445
            |.:.|:...|...||          |:..|.||..|.......:..:..::||       |:...
Mouse    71 TPSPGEGDGAPHLLA----------ASALADLSCGAREDFREDSEEAPCASTSCFEPTWCSSPTG 125

  Fly   446 TATPQQQVLS-------------------QRSEKSANGSSKPH-----------HPRQHHSDHSP 480
            .:.|.|....                   :.||:..:....|.           .|.......:|
Mouse   126 GSEPTQAFFEDELSDAESSCSDSAILDAPEASEEPDDSGEVPEGPPGARPAPSTGPTYRRRQITP 190

  Fly   481 DAKRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAK 545
            .:||  |:|.|.||.|.|.||||||:||||||||:|:.|.|..|:.:|.|||||.||||.|||.|
Mouse   191 ASKR--HQCSFHGCNKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHTGEK 253

  Fly   546 PFKCRNCDRCFSRSDHLALHMKRH 569
            .|.|..|.:.|||||||..|.:||
Mouse   254 RFSCPLCPKQFSRSDHLTKHARRH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 51/133 (38%)
C2H2 Zn finger 489..511 CDD:275368 15/21 (71%)
zf-H2C2_2 503..>519 CDD:290200 12/15 (80%)
C2H2 Zn finger 519..541 CDD:275368 13/21 (62%)
zf-H2C2_2 533..558 CDD:290200 14/24 (58%)
C2H2 Zn finger 549..569 CDD:275368 10/19 (53%)
Klf14NP_001128565.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..196 7/44 (16%)
COG5048 198..>283 CDD:227381 50/80 (63%)
C2H2 Zn finger 200..219 CDD:275368 13/18 (72%)
zf-H2C2_2 211..238 CDD:290200 16/26 (62%)
C2H2 Zn finger 227..249 CDD:275368 13/21 (62%)
zf-H2C2_2 241..266 CDD:290200 14/24 (58%)
C2H2 Zn finger 257..277 CDD:275368 10/19 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..325 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841557
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.