DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and klf8

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001073472.1 Gene:klf8 / 562805 ZFINID:ZDB-GENE-070424-152 Length:343 Species:Danio rerio


Alignment Length:304 Identity:112/304 - (36%)
Similarity:154/304 - (50%) Gaps:50/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 NSTPATAILRF----TSQSNPTMTQLQQQQQQLAVQHLSISPQALGHSNIGSNSPKSSSSSSSNS 353
            :|.|...|:..    ..|:.|....|.:.:..|.:...:.:|..|...||       ::|::..:
Zfish    62 SSPPPLCIISTQHSDADQTEPVDLSLNKPRPSLPIATATSTPANLPPQNI-------TASATIPA 119

  Fly   354 SNSSSSSHSSSSSISG-----------SSDQPTH----SNIP---RSTIVRLTT--ANGKPGAAG 398
            ..|..|..:|:..:.|           |.:.|:.    ..||   :|..|..||  .:|...|| 
Zfish   120 VLSQGSILASTQGVGGQQILHVIHTIPSVNMPSKLGQLQTIPVVVQSLPVVYTTVPTDGMATAA- 183

  Fly   399 ISLARVIQMQNNGNANVAAVLSAAANSGSSNSNSNSSSSNTSSNSINTATPQQQVLSQRSEKSAN 463
               ..|..:.::|.:..:..:...:.|.....:.:.:.|.|.|.|.:.:|       |..|.|.|
Zfish   184 ---ITVPLIGSDGRSEGSVRIKPGSTSPVEYQSESDAESGTESGSASFST-------QGMEPSIN 238

  Fly   464 GS-SKPHHPRQHHSDHSPDAK-RRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEW 526
            .. ..|..|      .|||.| ||:|.|.:.||.||||||||||||:|.|||||||:|:||||.|
Zfish   239 TDVDIPADP------DSPDMKRRRVHMCDYDGCNKVYTKSSHLKAHRRIHTGEKPYQCTWEGCTW 297

  Fly   527 RFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRHM 570
            |||||||||||:|||||.|||:|.:|||.||||||||||.:||:
Zfish   298 RFARSDELTRHFRKHTGIKPFRCTDCDRSFSRSDHLALHRRRHV 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 67/105 (64%)
C2H2 Zn finger 489..511 CDD:275368 16/21 (76%)
zf-H2C2_2 503..>519 CDD:290200 13/15 (87%)
C2H2 Zn finger 519..541 CDD:275368 18/21 (86%)
zf-H2C2_2 533..558 CDD:290200 18/24 (75%)
C2H2 Zn finger 549..569 CDD:275368 14/19 (74%)
klf8NP_001073472.1 repressor motif 82..86 1/3 (33%)
zf-C2H2 258..282 CDD:278523 17/23 (74%)
C2H2 Zn finger 260..282 CDD:275368 16/21 (76%)
COG5048 <265..>330 CDD:227381 52/64 (81%)
zf-H2C2_2 274..>291 CDD:290200 13/16 (81%)
C2H2 Zn finger 290..312 CDD:275368 18/21 (86%)
zf-H2C2_2 304..329 CDD:290200 18/24 (75%)
C2H2 Zn finger 320..340 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585896
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.