DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and KLF3

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_057615.3 Gene:KLF3 / 51274 HGNCID:16516 Length:345 Species:Homo sapiens


Alignment Length:302 Identity:111/302 - (36%)
Similarity:144/302 - (47%) Gaps:60/302 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 LQQQQQQLAVQHLSISPQALGHSNIGSNSPKSSSSSSSNSSNSSSSSHSSSSSISGSSDQPTHSN 378
            :|.:...|.|...| ||.:.|:|......|.|...:|...|..|||......|......||  ..
Human    57 IQMEPVDLTVNKRS-SPPSAGNSPSSLKFPSSHRRASPGLSMPSSSPPIKKYSPPSPGVQP--FG 118

  Fly   379 IPRSTIVRLTTANGKPGAAGISLARVIQ--------------------------MQNNGNANVAA 417
            :|.|....:..|..:.|.....:..|||                          |:|:.::....
Human   119 VPLSMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSSMQVP 183

  Fly   418 VLSA----------AANSGSSNSNSNSSSSNTSSNSINTATPQQQVLSQRSEKSANGSSKPHHP- 471
            |:.:          ....|.....::......|...:|:.:|.|.:|.:            :|| 
Human   184 VIESYEKPISQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQE------------NHPS 236

  Fly   472 ------RQHHSDHSPDA--KRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRF 528
                  ::.....|||.  |||||:|.:.||.||||||||||||:|||||||||||:||||.|:|
Human   237 VIVQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKF 301

  Fly   529 ARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRHM 570
            |||||||||:|||||.|||:|.:|||.||||||||||.||||
Human   302 ARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 65/112 (58%)
C2H2 Zn finger 489..511 CDD:275368 16/21 (76%)
zf-H2C2_2 503..>519 CDD:290200 14/15 (93%)
C2H2 Zn finger 519..541 CDD:275368 17/21 (81%)
zf-H2C2_2 533..558 CDD:290200 18/24 (75%)
C2H2 Zn finger 549..569 CDD:275368 15/19 (79%)
KLF3NP_057615.3 Repressor domain 1..74 6/17 (35%)
KLF3_N 49..260 CDD:410554 42/217 (19%)
9aaTAD, inactive. /evidence=ECO:0000269|PubMed:31375868 60..68 2/7 (29%)
CTBP-binding motif 61..65 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..112 14/46 (30%)
zf-C2H2 260..284 CDD:395048 17/23 (74%)
C2H2 Zn finger 262..284 CDD:275368 16/21 (76%)
C2H2 Zn finger 292..314 CDD:275368 17/21 (81%)
zf-H2C2_2 306..331 CDD:404364 18/24 (75%)
C2H2 Zn finger 322..342 CDD:275368 15/19 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151400
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.