DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and Klf13

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_067341.2 Gene:Klf13 / 50794 MGIID:1354948 Length:289 Species:Mus musculus


Alignment Length:131 Identity:64/131 - (48%)
Similarity:79/131 - (60%) Gaps:8/131 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 ATPQQQVLSQ-----RSEKSANGSSKP---HHPRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSH 503
            |.|.....|:     ..|....||.:|   ...|:..|....::.:|.|||.:.||:|||.||||
Mouse   120 AAPPSPAWSEPEAALEQEPGPAGSGEPGLRQRGRRGRSRADLESPQRKHKCHYAGCEKVYGKSSH 184

  Fly   504 LKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKR 568
            ||||.||||||:|:.|||:.|..:|||||||.||||.|||.|.|.|..|::.|.|||||..|.:|
Mouse   185 LKAHLRTHTGERPFACSWQECNKKFARSDELARHYRTHTGEKKFSCPICEKRFMRSDHLTKHARR 249

  Fly   569 H 569
            |
Mouse   250 H 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 54/111 (49%)
C2H2 Zn finger 489..511 CDD:275368 15/21 (71%)
zf-H2C2_2 503..>519 CDD:290200 12/15 (80%)
C2H2 Zn finger 519..541 CDD:275368 15/21 (71%)
zf-H2C2_2 533..558 CDD:290200 14/24 (58%)
C2H2 Zn finger 549..569 CDD:275368 9/19 (47%)
Klf13NP_067341.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..54
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..168 10/47 (21%)
COG5048 <163..253 CDD:227381 55/88 (63%)
C2H2 Zn finger 170..192 CDD:275368 15/21 (71%)
C2H2 Zn finger 200..222 CDD:275368 15/21 (71%)
C2H2 Zn finger 230..250 CDD:275368 9/19 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..289 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841530
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.