DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and Klf13

DIOPT Version :10

Sequence 1:NP_995811.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001425194.1 Gene:Klf13 / 499171 RGDID:1565099 Length:289 Species:Rattus norvegicus


Alignment Length:114 Identity:61/114 - (53%)
Similarity:75/114 - (65%) Gaps:3/114 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 EKSANGSSKP---HHPRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCS 520
            |....||.:|   ...|:..|....::.:|.|||.:.||:|||.||||||||.||||||:|:.||
  Rat   137 EPGPAGSGEPGLRQRGRRGRSRADLESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACS 201

  Fly   521 WEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRH 569
            |:.|..:|||||||.||||.|||.|.|.|..|::.|.|||||..|.:||
  Rat   202 WQECNKKFARSDELARHYRTHTGEKKFSCPICEKRFMRSDHLTKHARRH 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_995811.1 KLF6_7_N-like 2..>82 CDD:409246
COG5048 <455..>559 CDD:227381 53/102 (52%)
C2H2 Zn finger 489..511 CDD:275368 15/21 (71%)
C2H2 Zn finger 519..541 CDD:275368 15/21 (71%)
zf-H2C2_2 533..558 CDD:463886 14/24 (58%)
C2H2 Zn finger 549..569 CDD:275368 9/19 (47%)
Klf13NP_001425194.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.