DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and l(3)neo38

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001262485.1 Gene:l(3)neo38 / 41423 FlyBaseID:FBgn0265276 Length:455 Species:Drosophila melanogaster


Alignment Length:393 Identity:89/393 - (22%)
Similarity:152/393 - (38%) Gaps:86/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 KNHPGSNARMHLGHVQDFVLPTLTPPSSPESNLRSHNYAQQLEANDLAALIQQQQQQQQQQQQQQ 282
            :|.|..:|..::.:.|:..:|.    |.|:.:|   |:.....|.|....|..:.::.:::...|
  Fly    64 QNVPNVSAANNMQYGQNISIPY----SQPQGDL---NFLNAAAAADHKGKIHPKIERDREEVLNQ 121

  Fly   283 QQQQLNPQPGNSTPATAILRFTSQSNPTMTQLQQQQQQLAVQHL-----SISPQALGH-----SN 337
            |..|      |...:...|..|:.:....:.|......:::||.     :|..::.|.     :|
  Fly   122 QILQ------NVNQSWQTLANTANTVDYSSHLLSATLPISIQHFLKYSETIKKESTGDVLKNGTN 180

  Fly   338 IGSNSPKSSSSSSSNSSNSSSSSHSSSSSISGSSDQPTHSNIPRSTIVRLTTANGKPGAAGISLA 402
            :.|.:....:.:.||  |.::..|  .:.:.| .|...|       :..:|.|||.....|.|  
  Fly   181 LASLALGGVALTPSN--NGANGGH--HNGLVG-MDHGGH-------MTNMTDANGAALTNGAS-- 231

  Fly   403 RVIQMQN--NGNANVAAVLSAAANSGSSNSNSNSSSSNTSSNSINTAT----------------P 449
                  |  |||||      ....:|.:.:.|:|.|..|::.|..|.|                |
  Fly   232 ------NGVNGNAN------GTVTNGGAGAVSSSGSVGTTNASGGTGTASGKKTKKKKPPKEKKP 284

  Fly   450 QQQVLSQRSEKSANGSS-------KPHHP-----RQHHSDHSPDAKRRIHKCQFLGCKKVYTKSS 502
            :.:....|..|:.:||:       :..:|     .||...|   |..|...|..  |.....:..
  Fly   285 RPKPGEIRETKALDGSTLYCCPECQMAYPDRSLIEQHVISH---AVERRFVCDI--CNAALKRKD 344

  Fly   503 HLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMK 567
            ||..|:.:|..::|:.|:.  |...|.|.::||.|...|:|.|...|..|.:.|.|.|||..|.:
  Fly   345 HLTRHKLSHIPDRPHVCNI--CMKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKHTR 407

  Fly   568 RHM 570
            .|:
  Fly   408 SHI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 30/115 (26%)
C2H2 Zn finger 489..511 CDD:275368 5/21 (24%)
zf-H2C2_2 503..>519 CDD:290200 5/15 (33%)
C2H2 Zn finger 519..541 CDD:275368 7/21 (33%)
zf-H2C2_2 533..558 CDD:290200 9/24 (38%)
C2H2 Zn finger 549..569 CDD:275368 8/19 (42%)
l(3)neo38NP_001262485.1 C2H2 Zn finger 305..325 CDD:275368 3/19 (16%)
zf-C2H2_8 306..391 CDD:292531 24/91 (26%)
C2H2 Zn finger 333..353 CDD:275368 5/21 (24%)
zf-H2C2_2 345..370 CDD:290200 8/26 (31%)
C2H2 Zn finger 361..381 CDD:275368 7/21 (33%)
zf-H2C2_2 374..398 CDD:290200 9/23 (39%)
C2H2 Zn finger 389..409 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.