DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and sp6

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_991195.1 Gene:sp6 / 402928 ZFINID:ZDB-GENE-040426-1824 Length:278 Species:Danio rerio


Alignment Length:144 Identity:62/144 - (43%)
Similarity:83/144 - (57%) Gaps:9/144 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 SNSSSSNTSSNSINTA-TPQQQVLSQRSEKSANGSSKPHHPRQHHSD---HSPDAKRR--IHKCQ 490
            |.|.||....:::..| .|:.|   :|....|.|.:....|....::   :|.||.:|  :|.|.
Zfish    94 SASFSSEEQQDAVAAAGRPKPQ---RRPSSRAPGQASCRCPNCLSAESLGNSGDASKRKHLHNCH 155

  Fly   491 FLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRC 555
            ..||.|.|.|:||||||.|.|:|::|:.|:|..|..||.|||||.||.:.|||||.|.|.:|.|.
Zfish   156 IPGCGKAYVKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQTHTGAKRFGCSSCPRV 220

  Fly   556 FSRSDHLALHMKRH 569
            |.|:||||.||:.|
Zfish   221 FLRADHLAKHMRVH 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 47/108 (44%)
C2H2 Zn finger 489..511 CDD:275368 13/21 (62%)
zf-H2C2_2 503..>519 CDD:290200 9/15 (60%)
C2H2 Zn finger 519..541 CDD:275368 12/21 (57%)
zf-H2C2_2 533..558 CDD:290200 14/24 (58%)
C2H2 Zn finger 549..569 CDD:275368 11/19 (58%)
sp6NP_991195.1 zf-C2H2_8 154..240 CDD:292531 46/81 (57%)
C2H2 Zn finger 157..176 CDD:275368 12/18 (67%)
zf-H2C2_2 168..195 CDD:290200 14/26 (54%)
C2H2 Zn finger 184..206 CDD:275368 12/21 (57%)
C2H2 Zn finger 214..234 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585897
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.