DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and CG42741

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster


Alignment Length:332 Identity:118/332 - (35%)
Similarity:154/332 - (46%) Gaps:108/332 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 SISPQALGHSNIGSNSPKSSSSSSSNSSNSSSSSHSSS-SSISGSSDQPTH-----SNIPRS--- 382
            |.:.:|:|:||   ..|..||.|||:|...:.|:.||| .:.:....|..:     |.:|.|   
  Fly    50 SSANKAVGYSN---GKPGGSSGSSSSSGFGAGSAGSSSLGAFAAQQQQQLYASSGVSKLPFSPFF 111

  Fly   383 -------TIVRLTTANGKPGAAGISLARVIQMQNNGNANVAAVLSAAANSGSSNSNSNSSSSNTS 440
                   |..|::.:....|...:|   |.|..||             ||.|.|:.|:|..:.::
  Fly   112 AASPFFFTYRRISGSGSGNGTGSVS---VKQEDNN-------------NSCSYNNGSSSGGAGSA 160

  Fly   441 SNSINTATPQQQVLS-------------QRSEKSA--NGSSKP----HHP--RQHHSDHSPDA-- 482
            :||:.....:..:||             |.|.|::  .|||||    ..|  :.:....||.|  
  Fly   161 ANSMQDYESKFSLLSLFKNPYKFAGGDGQASRKTSPTGGSSKPLASNSSPSWKSYAGSGSPHAAL 225

  Fly   483 --------------------------------------------------KRRIHKCQFLGCKKV 497
                                                              .|::|||...||.||
  Fly   226 NPAFGGMGRGATRKDNSSFSGINFGGGGSAFGFTTSSDSMANGGYNDLSKNRKVHKCDTEGCDKV 290

  Fly   498 YTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHL 562
            ||||||||||:|||||||||.|:||||.||||||||||||||||||.|||:|:.|.|.|||||||
  Fly   291 YTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHL 355

  Fly   563 ALHMKRH 569
            :|||:||
  Fly   356 SLHMRRH 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 71/176 (40%)
C2H2 Zn finger 489..511 CDD:275368 16/21 (76%)
zf-H2C2_2 503..>519 CDD:290200 14/15 (93%)
C2H2 Zn finger 519..541 CDD:275368 19/21 (90%)
zf-H2C2_2 533..558 CDD:290200 18/24 (75%)
C2H2 Zn finger 549..569 CDD:275368 13/19 (68%)
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 58/78 (74%)
zf-C2H2 280..304 CDD:278523 18/23 (78%)
C2H2 Zn finger 282..304 CDD:275368 16/21 (76%)
zf-H2C2_2 296..>313 CDD:290200 14/16 (88%)
C2H2 Zn finger 312..334 CDD:275368 19/21 (90%)
zf-H2C2_2 326..351 CDD:290200 18/24 (75%)
C2H2 Zn finger 342..362 CDD:275368 13/19 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455435
Domainoid 1 1.000 40 1.000 Domainoid score I3723
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D416605at33208
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.