DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and Cf2

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:342 Identity:93/342 - (27%)
Similarity:135/342 - (39%) Gaps:83/342 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 DFVLPTLTPPS---SPESNLRSHNYAQQLEANDLAALIQQQQQQQQQQQQQQQQQQLNPQPGNST 295
            |..||.:.|..   :||    ..::.|||:|..     ..|||.|||||||||||:|..|     
  Fly   207 DDQLPAMAPRDMRLTPE----EQHHQQQLQAEH-----HHQQQHQQQQQQQQQQQELLEQ----- 257

  Fly   296 PATAILRFTSQSNPTMTQLQQQQQQLAVQHLSISPQALGHSNIGSNSPKSSSSSSSNSSNSSSSS 360
                          ...::|:|.||..|.|                                   
  Fly   258 --------------QQREMQEQAQQQQVHH----------------------------------- 273

  Fly   361 HSSSSSISGSSDQPTHSNIPRSTIVRLTTANGKPGAAGISLARVI------QMQNNGN-ANVAAV 418
            |.....::|  || ....:|..|:.....||   |.|.:|..:||      .:.::|: .|...|
  Fly   274 HQQDQDLAG--DQ-VALKVPPLTVKLNKNAN---GGAIVSHPQVIIKEEPLSLSDSGDVVNSVPV 332

  Fly   419 LSAAANSGSSNSNSNSSSSNTSSNSINTATPQQQVLSQRSEKSANGSSKPHHPRQHHSDHSPDAK 483
            .:..||.|.....|:.....|.:...:.|...:.......:......:...|.:.|..:.....|
  Fly   333 YAIQANPGVPAPASSGVLVGTQTVPADLAHKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPK 397

  Fly   484 RRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFK 548
            .|.:.|.:  |.|.:|:|:.||.|.|.||||||:.|.:  ||..|:..|.||:|.|.|||.||:.
  Fly   398 ERPYTCSY--CGKSFTQSNTLKQHTRIHTGEKPFHCGY--CEKSFSVKDYLTKHIRTHTGEKPYT 458

  Fly   549 CRNCDRCFSRSDHLALH 565
            |..||:.|::...|.:|
  Fly   459 CPYCDKRFTQRSALTVH 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 37/103 (36%)
C2H2 Zn finger 489..511 CDD:275368 9/21 (43%)
zf-H2C2_2 503..>519 CDD:290200 10/15 (67%)
C2H2 Zn finger 519..541 CDD:275368 9/21 (43%)
zf-H2C2_2 533..558 CDD:290200 13/24 (54%)
C2H2 Zn finger 549..569 CDD:275368 6/17 (35%)
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 37/110 (34%)
C2H2 Zn finger 368..388 CDD:275368 1/19 (5%)
C2H2 Zn finger 403..423 CDD:275368 9/21 (43%)
C2H2 Zn finger 431..451 CDD:275368 9/21 (43%)
zf-H2C2_2 443..468 CDD:316026 13/24 (54%)
C2H2 Zn finger 459..480 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I1951
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.