DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and cbt

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster


Alignment Length:379 Identity:105/379 - (27%)
Similarity:171/379 - (45%) Gaps:80/379 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 DFVLPTLTPPSSPESNLRSHNYAQQLEANDLAALIQQQQQQQQQ----------QQQQQQQQQLN 288
            |.:||  :||::|           .|..|.|..:.:.:||..:.          |:.|:....:.
  Fly     4 DTLLP--SPPATP-----------PLRENKLEIVAKDEQQVNENLLKAKLKLVAQKSQKNGGIIT 55

  Fly   289 PQPGNS---TPATAILRFTSQ-SNPTMTQLQQQQQQL----AVQHLSISPQALGHSNIGSNSPKS 345
            |.|.::   .|..|:.....: ..|.|:......|:|    ..:.:|:..:......:.|:|...
  Fly    56 PNPSDTEDEAPEIAVPNKKPRLEQPAMSMTPPPDQKLDDDQKAERVSVIMRVNSSGAVSSSSQDE 120

  Fly   346 SSSSSSNSSNSSSSSHSSSSSISGS-SDQPTHSNI-----------------------PRSTIVR 386
            :||||::..:|||::::|:||:..: .|....:|:                       |.:.:.:
  Fly   121 NSSSSTSCCSSSSNTNTSTSSVPPTVEDDYPEANVWRNLKFKMNRKRAAEVALPPVQTPETPVAK 185

  Fly   387 LTTANGKPGAAGISLARVIQMQNNGNANVAAVLSAAANSGSSNSNSNSSSSNTSSNSI-NTATPQ 450
            |.|    |.|.    |..|:.:..........:|..|:|.|.....::.::..|...: .|.|..
  Fly   186 LVT----PPAP----AECIKEEEIKPILTPIYVSPVASSASQLILLSTVAAQQSPTPVPKTPTMS 242

  Fly   451 QQVLSQRSEKSANGSSKPHHPRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEK 515
            ::.|:.|...:...::                :.||::|.|..|.|.|.||||||||||.||||:
  Fly   243 EEKLTTRITAAQAAAT----------------RSRIYECSFPDCGKNYFKSSHLKAHQRVHTGER 291

  Fly   516 PYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRH 569
            |:.|.||.|:.||:|||||:||.|.|||.|.|:|..|.:.|.|||||:.|:|||
  Fly   292 PFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLSKHVKRH 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 45/103 (44%)
C2H2 Zn finger 489..511 CDD:275368 15/21 (71%)
zf-H2C2_2 503..>519 CDD:290200 12/15 (80%)
C2H2 Zn finger 519..541 CDD:275368 14/21 (67%)
zf-H2C2_2 533..558 CDD:290200 13/24 (54%)
C2H2 Zn finger 549..569 CDD:275368 10/19 (53%)
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 15/23 (65%)
C2H2 Zn finger 265..287 CDD:275368 15/21 (71%)
COG5048 <270..362 CDD:227381 49/76 (64%)
zf-H2C2_2 279..306 CDD:290200 18/26 (69%)
C2H2 Zn finger 295..317 CDD:275368 14/21 (67%)
zf-H2C2_2 309..332 CDD:290200 12/22 (55%)
zf-C2H2 323..345 CDD:278523 11/21 (52%)
C2H2 Zn finger 325..345 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3870
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.