DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and Klf15

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster


Alignment Length:157 Identity:66/157 - (42%)
Similarity:82/157 - (52%) Gaps:35/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 SNSNSNSSS-----------SNTSSNSINTATPQQQVLS----QRSEKSANGSSKPHHPRQHHSD 477
            ||||...|.           |::|..|.::|:|.:.|..    |.||.:|.              
  Fly   143 SNSNLRLSGPPHSEIFVPDRSSSSPGSSDSASPAEAVAPPSALQMSENAAG-------------- 193

  Fly   478 HSPDAKRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHT 542
                  .|.:.|.|..|:|:|.|.:|||||.|.|.|||||.|||..|.|||:|||||.||.|.|:
  Fly   194 ------ERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELARHKRSHS 252

  Fly   543 GAKPFKCRNCDRCFSRSDHLALHMKRH 569
            |.||:||..|.:||:|||||..|.|.|
  Fly   253 GVKPYKCDYCSKCFARSDHLTKHRKVH 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 47/107 (44%)
C2H2 Zn finger 489..511 CDD:275368 12/21 (57%)
zf-H2C2_2 503..>519 CDD:290200 12/15 (80%)
C2H2 Zn finger 519..541 CDD:275368 15/21 (71%)
zf-H2C2_2 533..558 CDD:290200 14/24 (58%)
C2H2 Zn finger 549..569 CDD:275368 11/19 (58%)
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 48/78 (62%)
C2H2 Zn finger 203..221 CDD:275368 10/17 (59%)
C2H2 Zn finger 229..251 CDD:275368 15/21 (71%)
zf-H2C2_2 243..268 CDD:290200 14/24 (58%)
C2H2 Zn finger 259..279 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455436
Domainoid 1 1.000 40 1.000 Domainoid score I3723
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.