| Sequence 1: | NP_001260879.1 | Gene: | luna / 2768719 | FlyBaseID: | FBgn0040765 | Length: | 570 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001128566.1 | Gene: | Klf14 / 312203 | RGDID: | 1306012 | Length: | 321 | Species: | Rattus norvegicus |
| Alignment Length: | 258 | Identity: | 80/258 - (31%) |
|---|---|---|---|
| Similarity: | 108/258 - (41%) | Gaps: | 71/258 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 381 RSTIVRLTTANGKPGAAGISLARVIQMQNNGN--------------------------------A 413
Fly 414 NVAAVLSAAANSGSSNSNSNSSSSNTS-------SNSINTATPQQ--------QVLSQRSEKSAN 463
Fly 464 GSSK-PHH---------------------PRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSHLKA 506
Fly 507 HQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRH 569 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| luna | NP_001260879.1 | COG5048 | <455..>559 | CDD:227381 | 53/125 (42%) |
| C2H2 Zn finger | 489..511 | CDD:275368 | 15/21 (71%) | ||
| zf-H2C2_2 | 503..>519 | CDD:290200 | 12/15 (80%) | ||
| C2H2 Zn finger | 519..541 | CDD:275368 | 13/21 (62%) | ||
| zf-H2C2_2 | 533..558 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 549..569 | CDD:275368 | 10/19 (53%) | ||
| Klf14 | NP_001128566.1 | COG5048 | 198..>283 | CDD:227381 | 50/80 (63%) |
| C2H2 Zn finger | 200..219 | CDD:275368 | 13/18 (72%) | ||
| zf-H2C2_2 | 211..238 | CDD:290200 | 16/26 (62%) | ||
| C2H2 Zn finger | 227..249 | CDD:275368 | 13/21 (62%) | ||
| zf-H2C2_2 | 241..266 | CDD:290200 | 14/24 (58%) | ||
| C2H2 Zn finger | 257..277 | CDD:275368 | 10/19 (53%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166344915 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||