DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment luna and Klf2

DIOPT Version :9

Sequence 1:	NP_001260879.1	Gene:	luna / 2768719	FlyBaseID:	FBgn0040765	Length:	570	Species:	Drosophila melanogaster
Sequence 2:	NP_001007685.1	Gene:	Klf2 / 306330	RGDID:	1359220	Length:	351	Species:	Rattus norvegicus

Alignment Length:	105	Identity:	69/105 - (65%)
Similarity:	78/105 - (74%)	Gaps:	4/105 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   466 SKPHHPRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFAR 530
            :||...|:..    |..:...|.|.:..|.|.||||||||||.|||||||||.|:|:||.|:|||
  Rat   251 AKPKRGRRSW----PRKRAATHTCSYTNCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFAR 311

  Fly   531 SDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRHM 570
            |||||||||||||.:||:|..|||.|||||||||||||||
  Rat   312 SDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM 351

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
luna	NP_001260879.1	COG5048	<455..>559	CDD:227381	56/92 (61%)
		C2H2 Zn finger	489..511	CDD:275368	14/21 (67%)
		zf-H2C2_2	503..>519	CDD:290200	14/15 (93%)
		C2H2 Zn finger	519..541	CDD:275368	17/21 (81%)
		zf-H2C2_2	533..558	CDD:290200	18/24 (75%)
		C2H2 Zn finger	549..569	CDD:275368	16/19 (84%)
Klf2	NP_001007685.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	20..110
		9aaTAD. /evidence=ECO:0000250\|UniProtKB:Q9Y5W3	42..50
		Interaction with WWP1. /evidence=ECO:0000250	110..264		4/16 (25%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	156..209
		COG5048	<266..346	CDD:227381	58/79 (73%)
		zf-C2H2	268..292	CDD:278523	15/23 (65%)
		C2H2 Zn finger	270..292	CDD:275368	14/21 (67%)
		zf-H2C2_2	284..>306	CDD:290200	17/21 (81%)
		C2H2 Zn finger	300..322	CDD:275368	17/21 (81%)
		zf-H2C2_2	314..339	CDD:290200	18/24 (75%)
		C2H2 Zn finger	330..350	CDD:275368	16/19 (84%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166344920
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	191	1.000	Inparanoid score	I3785
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23235
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	6	5.990