DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and wt1a

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_571121.1 Gene:wt1a / 30245 ZFINID:ZDB-GENE-980526-558 Length:419 Species:Danio rerio


Alignment Length:451 Identity:105/451 - (23%)
Similarity:159/451 - (35%) Gaps:134/451 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 GNTTGSSNIIASPLSSLGSGS---TITVSSRNSSAPGIKVRVVQAKNHPGSNARMHLGHVQDFVL 237
            |:.....|.:..|:..|..|:   |:.|||.....|.:.               .|.|       
Zfish     2 GSDVRDLNTLLPPVPPLPGGNGNCTLPVSSTPQWPPMLD---------------FHTG------- 44

  Fly   238 PTLTPPSSPESNLRSHNYAQQLEANDLAALIQQQQQQQQQQQQQQQQQQLNPQPGNSTP------ 296
                   :|..:|..|::.:|                             .|..|.:.|      
Zfish    45 -------APYGSLAQHSFIKQ-----------------------------EPSWGTADPHEDPHC 73

  Fly   297 --------------ATAILRFTSQSNPTMTQLQQQQQQLAVQHLSISPQALGHSNIGSNSPKSSS 347
                          .|...|:.:...|..:|....|           |:...:|...||...|.|
Zfish    74 GLSAFTVHFSGQFTGTGACRYGAFGAPAASQPPPSQ-----------PRMFSNSPYLSNCMDSQS 127

  Fly   348 SSSSNS------SNSSSSSHSSSSSISGSSDQPTHSNIPRSTIVRLTTANGK-----PGAAGI-- 399
            ||.:..      ..:|:..|:.|..   :...|.||.....:|.:.:....:     |...|.  
Zfish   128 SSRNQGYGTVAFDGASNYGHTPSHH---TPQFPNHSFKHEDSITQQSNMGDQQYPVPPPVYGCHT 189

  Fly   400 -------SLARVIQMQNNGNANVAAVLSAAANSGSSNSNSNSSS--SNTSSNSINTATPQQQVLS 455
                   |.|.:::...|.:.|:..:.|.....|.:..||.:|:  |:......:.:||.....|
Zfish   190 PSDSCTGSQALLLRNPYNSSDNLYQMASQLECMGWNPVNSLASTIKSHPGGYESDPSTPMVYSCS 254

  Fly   456 QRSEKSANGSSK------------PHHPRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSHLKAHQ 508
            .:.....:|..:            |...|...::     ::|...|.:.||.|.|.|.|||:.|.
Zfish   255 TQYRIHTHGVFRGLQDVRRVPGITPAIVRSTETN-----EKRPFMCAYPGCNKRYFKLSHLQMHS 314

  Fly   509 RTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRH 569
            |.|||||||:|.:..|..||:|||:|.||.|:|||.|||:|..|.|.|||||||..|.:.|
Zfish   315 RKHTGEKPYQCDFTDCGRRFSRSDQLKRHQRRHTGVKPFQCETCQRKFSRSDHLKTHTRTH 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 45/115 (39%)
C2H2 Zn finger 489..511 CDD:275368 11/21 (52%)
zf-H2C2_2 503..>519 CDD:290200 11/15 (73%)
C2H2 Zn finger 519..541 CDD:275368 11/21 (52%)
zf-H2C2_2 533..558 CDD:290200 14/24 (58%)
C2H2 Zn finger 549..569 CDD:275368 11/19 (58%)
wt1aNP_571121.1 WT1 1..291 CDD:280348 57/365 (16%)
COG5048 286..>411 CDD:227381 48/95 (51%)
C2H2 Zn finger 298..317 CDD:275368 10/18 (56%)
zf-H2C2_2 309..336 CDD:290200 15/26 (58%)
C2H2 Zn finger 325..347 CDD:275368 11/21 (52%)
zf-H2C2_2 340..364 CDD:290200 14/23 (61%)
C2H2 Zn finger 355..375 CDD:275368 11/19 (58%)
C2H2 Zn finger 386..408 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.