DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and Sp7

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_852039.2 Gene:Sp7 / 300260 RGDID:631377 Length:428 Species:Rattus norvegicus


Alignment Length:538 Identity:131/538 - (24%)
Similarity:176/538 - (32%) Gaps:207/538 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LLEELKIKEQHLDTISTTSSVSSNCSGTSWDSNGSQALSCSVLVKQERIDEEDDDVGCDDKLSVL 134
            ||||    |.|..: |..:.:::.||    ...||..|..|..:.:....:...|:.....:...
  Rat     5 LLEE----EAHYGS-SPLAMLTAACS----KFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDA 60

  Fly   135 LAAP---------PSAISPNPSIGSAGNMTPTSIS-------NSSSISSSNSHSNSNGNTTGSSN 183
            ..||         |:...|.|:.|.|.:..|...|       ....:.....||        ||:
  Rat    61 YPAPFSSTNGLLSPAGSPPAPASGYANDYPPFPHSFPGPTGAQDPGLLVPKGHS--------SSD 117

  Fly   184 IIASPLSSL------GSGSTITVSSRNSSAPGIKVRVVQAKN--------HPGSNARMHLGHVQ- 233
            .:.|..:||      ||.....:.:..|..||         |        |||.|   .||..| 
  Rat   118 CLPSVYTSLDMSHPYGSWYKAGIHAGISPGPG---------NTPTPWWDMHPGGN---WLGGGQG 170

  Fly   234 --DFVLPTL-TPPSSPESNLRSHNYAQQLEANDLAALIQQQQQQQQQQQQQQQQQQLNPQPGNST 295
              |.:..|| |.|:.|..|.:...|     .:|.|                    .|||.|   .
  Rat   171 QGDGLQGTLSTGPAQPPLNPQLPTY-----PSDFA--------------------PLNPAP---Y 207

  Fly   296 PATAILRFTSQSNPTMTQLQQQQQQLAVQHL----SISPQALGHSNIGSNSPKSSSSSSSNSSNS 356
            ||..:|    |..|              ||:    ...|:|:|                      
  Rat   208 PAPHLL----QPGP--------------QHVLPQDVYKPKAVG---------------------- 232

  Fly   357 SSSSHSSSSSISGSSDQPTHSNIPRSTIVRLTTANGKPGAAGISLARVIQMQNNGNANVAAVLSA 421
                  :|..:.||                   ..|||                         ..
  Rat   233 ------NSGQLEGS-------------------GAGKP-------------------------PR 247

  Fly   422 AANSGSSNSNSNSSSSNTSSNSINTATPQQQVLSQRSEKSANGSSKPHHPRQHHSDHSPDAKRRI 486
            .|.:|.|...:.|.:..::.:     .|..|.|.:....:|....||                 |
  Rat   248 GAGTGGSGGYAGSGAGRSTCD-----CPNCQELERLGAAAAGLRKKP-----------------I 290

  Fly   487 HKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCRN 551
            |.|...||.|||.|:||||||.|.||||:|:.|:|..|..||.|||||.||.|.||..|.|.|..
  Rat   291 HSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLL 355

  Fly   552 CDRCFSRSDHLALHMKRH 569
            |.:.|:|||||:.|.:.|
  Rat   356 CSKRFTRSDHLSKHQRTH 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 44/103 (43%)
C2H2 Zn finger 489..511 CDD:275368 14/21 (67%)
zf-H2C2_2 503..>519 CDD:290200 11/15 (73%)
C2H2 Zn finger 519..541 CDD:275368 13/21 (62%)
zf-H2C2_2 533..558 CDD:290200 12/24 (50%)
C2H2 Zn finger 549..569 CDD:275368 9/19 (47%)
Sp7NP_852039.2 C2H2 Zn finger 296..315 CDD:275368 13/18 (72%)
COG5048 <306..373 CDD:227381 38/66 (58%)
zf-H2C2_2 307..334 CDD:290200 16/26 (62%)
C2H2 Zn finger 323..345 CDD:275368 13/21 (62%)
zf-H2C2_2 337..362 CDD:290200 12/24 (50%)
C2H2 Zn finger 353..373 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.