DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and klf-3

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001022205.1 Gene:klf-3 / 191713 WormBaseID:WBGene00003480 Length:315 Species:Caenorhabditis elegans


Alignment Length:146 Identity:72/146 - (49%)
Similarity:93/146 - (63%) Gaps:20/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 NSGSSNSNSNSSSSNTSSNSINTATPQQQVLSQRSEKSANGSSKPHHPRQHHSDHSPDAKRRIHK 488
            ::|..:|..:|.||.|||        ::..|.::|...:|            ..:..|.|..:|.
 Worm   187 HNGELDSTRSSPSSTTSS--------ERSPLQRKSRIESN------------KRNPTDKKFVVHA 231

  Fly   489 CQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCD 553
            |.:.||.|.|:||||||||:|||:||||:.|.|:.|.|:||||||||||.|||||.|||:|..||
 Worm   232 CTYPGCFKKYSKSSHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTRHMRKHTGDKPFRCSLCD 296

  Fly   554 RCFSRSDHLALHMKRH 569
            |.|:|||||:||||||
 Worm   297 RNFARSDHLSLHMKRH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 52/103 (50%)
C2H2 Zn finger 489..511 CDD:275368 14/21 (67%)
zf-H2C2_2 503..>519 CDD:290200 12/15 (80%)
C2H2 Zn finger 519..541 CDD:275368 15/21 (71%)
zf-H2C2_2 533..558 CDD:290200 18/24 (75%)
C2H2 Zn finger 549..569 CDD:275368 14/19 (74%)
klf-3NP_001022205.1 C2H2 Zn finger 235..254 CDD:275368 13/18 (72%)
C2H2 Zn finger 262..284 CDD:275368 15/21 (71%)
zf-H2C2_2 276..301 CDD:290200 18/24 (75%)
C2H2 Zn finger 292..312 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.