DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and sptf-2

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_495833.1 Gene:sptf-2 / 188733 WormBaseID:WBGene00011926 Length:166 Species:Caenorhabditis elegans


Alignment Length:139 Identity:52/139 - (37%)
Similarity:73/139 - (52%) Gaps:14/139 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 SNSNSNSSSSNTSSNSINTATPQQQVLSQRSEKSANGSSKPHHPRQHHSDHSPDAKRRIHKCQFL 492
            ::::::||||:..:|.:.|           ..:.....:.|:.....|.|.   ..:..|.|...
 Worm    32 ASTSASSSSSSIGANELTT-----------KRRKCERCTCPNCKAIKHGDR---GSQHTHLCSVP 82

  Fly   493 GCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFS 557
            ||.|.|.|:|||:||.|.|||::|:.|.|..|..||.|||:|.||.|.||....|.|:.|.|.||
 Worm    83 GCGKTYKKTSHLRAHLRKHTGDRPFVCDWFDCGKRFDRSDQLIRHKRTHTKEYRFACKFCIRQFS 147

  Fly   558 RSDHLALHM 566
            |||||..|:
 Worm   148 RSDHLQQHL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 40/103 (39%)
C2H2 Zn finger 489..511 CDD:275368 12/21 (57%)
zf-H2C2_2 503..>519 CDD:290200 9/15 (60%)
C2H2 Zn finger 519..541 CDD:275368 12/21 (57%)
zf-H2C2_2 533..558 CDD:290200 11/24 (46%)
C2H2 Zn finger 549..569 CDD:275368 11/18 (61%)
sptf-2NP_495833.1 COG5048 <75..156 CDD:227381 42/80 (53%)
C2H2 Zn finger 82..101 CDD:275368 11/18 (61%)
C2H2 Zn finger 109..131 CDD:275368 12/21 (57%)
C2H2 Zn finger 139..156 CDD:275368 10/16 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161938
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.