DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and klf-2

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_507995.2 Gene:klf-2 / 186179 WormBaseID:WBGene00009998 Length:299 Species:Caenorhabditis elegans


Alignment Length:375 Identity:112/375 - (29%)
Similarity:147/375 - (39%) Gaps:147/375 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 SSAPGIKVRVVQAKNHPGSNARMHLGHVQDFVLPTLTPPSSPESNLRSHNYAQQLEANDLAALIQ 269
            ::||.|.|.          |...|.|.|.:.|:         |.:...||:.||....::     
 Worm    43 AAAPVINVH----------NYHFHTGPVNNQVI---------EQHYNHHNHVQQTFEENI----- 83

  Fly   270 QQQQQQQQQQQQQQQQQLNPQPGNSTPATAILRFTSQSNPTMTQLQQQQQQLAVQHLSISPQALG 334
                               ||..:|:     ..| |...|     ||...:..:.|:..|...:.
 Worm    84 -------------------PQGPHSS-----FNF-SHDFP-----QQNNSETHLNHMEPSMTPME 118

  Fly   335 HSNIGSNSPKSSSSSSSNSSNSSS-SSHSSSSSISGSSDQPTHSNIPRSTIVRLTTANGKPGAAG 398
            |.|.||::|....:.....|.::| ||:|.||.:||..::.     ||                 
 Worm   119 HQNSGSSTPYPFEAKLFVPSPAASVSSYSFSSDLSGKDEED-----PR----------------- 161

  Fly   399 ISLARVIQMQNNGNANVAAVLSAAANSGSSNSNSNSSSSNTSSNSINTATPQQQVLSQRSEKSAN 463
                  |.:::.|                                                    
 Worm   162 ------IPLKDRG---------------------------------------------------- 168

  Fly   464 GSSKPHHPRQHHSDHSPDAKR---------RIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKC 519
               :.:||:.........:||         |:|||.:.||.|||||||||.||:|.|:|||||.|
 Worm   169 ---RVYHPQSTEKPKKVPSKRRDKATLDRLRVHKCFYQGCGKVYTKSSHLTAHERVHSGEKPYPC 230

  Fly   520 SWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRH 569
            .|.||.||||||||||||||||||||||.|:.|.|.|||||||.||||||
 Worm   231 EWPGCSWRFARSDELTRHYRKHTGAKPFACKECSRKFSRSDHLQLHMKRH 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 59/112 (53%)
C2H2 Zn finger 489..511 CDD:275368 15/21 (71%)
zf-H2C2_2 503..>519 CDD:290200 11/15 (73%)
C2H2 Zn finger 519..541 CDD:275368 18/21 (86%)
zf-H2C2_2 533..558 CDD:290200 19/24 (79%)
C2H2 Zn finger 549..569 CDD:275368 14/19 (74%)
klf-2NP_507995.2 C2H2 Zn finger 205..222 CDD:275368 13/16 (81%)
C2H2 Zn finger 230..252 CDD:275368 18/21 (86%)
zf-H2C2_2 244..269 CDD:290200 19/24 (79%)
C2H2 Zn finger 260..280 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2079
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 1 1.000 - - otm14633
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.920

Return to query results.
Submit another query.