DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and Klf9

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_034768.2 Gene:Klf9 / 16601 MGIID:1333856 Length:244 Species:Mus musculus


Alignment Length:225 Identity:78/225 - (34%)
Similarity:108/225 - (48%) Gaps:37/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 SISGSSDQPTHSNIPRSTIVRL-----TTANGKPGAAGISLARVIQMQNNGNANVAAVLSAAANS 425
            |||..:..|.|...|.:..:||     |..:|.||...              .:...:::.|.:.
Mouse    17 SISNRAAVPEHGGAPEAERLRLPEREVTKEHGDPGDTW--------------KDYCTLVTIAKSL 67

  Fly   426 GSSNSNSNSSSSNTSSNSINTATPQQQVLSQRSEKSANGSSKPHHPRQHHSD----------HS- 479
            ...|......:.:..|:|:.  :|.:.:.|.....:.:|||..|.|.:....          || 
Mouse    68 LDLNKYRPIQTPSVCSDSLE--SPDEDIGSDSDVTTESGSSPSHSPEERQDSGSAPSPLSLLHSG 130

  Fly   480 -----PDAKRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYR 539
                 ..|..:.|||.:.||.|||.||||||||.|.||||:|:.|:|..|..:|:||||||||||
Mouse   131 VASKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDCLKKFSRSDELTRHYR 195

  Fly   540 KHTGAKPFKCRNCDRCFSRSDHLALHMKRH 569
            .|||.|.|:|..|::.|.|||||..|.:||
Mouse   196 THTGEKQFRCPLCEKRFMRSDHLTKHARRH 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 53/119 (45%)
C2H2 Zn finger 489..511 CDD:275368 15/21 (71%)
zf-H2C2_2 503..>519 CDD:290200 11/15 (73%)
C2H2 Zn finger 519..541 CDD:275368 14/21 (67%)
zf-H2C2_2 533..558 CDD:290200 15/24 (63%)
C2H2 Zn finger 549..569 CDD:275368 9/19 (47%)
Klf9NP_034768.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..51 6/24 (25%)
COG5048 <78..234 CDD:227381 64/150 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..143 12/65 (18%)
C2H2 Zn finger 145..167 CDD:275368 15/21 (71%)
C2H2 Zn finger 175..197 CDD:275368 14/21 (67%)
C2H2 Zn finger 205..225 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.