DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment luna and Klf2

DIOPT Version :9

Sequence 1:	NP_001260879.1	Gene:	luna / 2768719	FlyBaseID:	FBgn0040765	Length:	570	Species:	Drosophila melanogaster
Sequence 2:	NP_032478.2	Gene:	Klf2 / 16598	MGIID:	1342772	Length:	354	Species:	Mus musculus

Alignment Length:	105	Identity:	70/105 - (66%)
Similarity:	78/105 - (74%)	Gaps:	4/105 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   466 SKPHHPRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFAR 530
            :||...|:..    |..:...|.|.:..|.|.||||||||||.|||||||||.|:||||.|:|||
Mouse   254 AKPKRGRRSW----PRKRAATHTCSYTNCGKTYTKSSHLKAHLRTHTGEKPYHCNWEGCGWKFAR 314

  Fly   531 SDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRHM 570
            |||||||||||||.:||:|..|||.|||||||||||||||
Mouse   315 SDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM 354

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
luna	NP_001260879.1	COG5048	<455..>559	CDD:227381	57/92 (62%)
		C2H2 Zn finger	489..511	CDD:275368	14/21 (67%)
		zf-H2C2_2	503..>519	CDD:290200	14/15 (93%)
		C2H2 Zn finger	519..541	CDD:275368	18/21 (86%)
		zf-H2C2_2	533..558	CDD:290200	18/24 (75%)
		C2H2 Zn finger	549..569	CDD:275368	16/19 (84%)
Klf2	NP_032478.2	9aaTAD. /evidence=ECO:0000250\|UniProtKB:Q9Y5W3	42..50
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	52..111
		Interaction with WWP1	110..267		4/16 (25%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	145..208
		zf-C2H2	271..295	CDD:278523	15/23 (65%)
		C2H2 Zn finger	273..295	CDD:275368	14/21 (67%)
		COG5048	<276..>353	CDD:227381	61/76 (80%)
		zf-C2H2	301..325	CDD:278523	19/23 (83%)
		C2H2 Zn finger	303..325	CDD:275368	18/21 (86%)
		zf-H2C2_2	317..342	CDD:290200	18/24 (75%)
		C2H2 Zn finger	333..353	CDD:275368	16/19 (84%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167841562
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23235
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	3.940