DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and klf2b

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_571932.1 Gene:klf2b / 117509 ZFINID:ZDB-GENE-011109-2 Length:363 Species:Danio rerio


Alignment Length:245 Identity:91/245 - (37%)
Similarity:111/245 - (45%) Gaps:64/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 LSISPQALGHSNIGSNSPKSSSSSSSNSSNSSSSSHSSSSSISGSSDQPTHSNIPRSTIVRLTTA 390
            |::||||.|:    ...|.|...|....:..:.|.|.|         .|.:..:|          
Zfish   183 LAVSPQATGN----MTPPLSPDDSHLRQTTYTQSYHHS---------PPAYPQVP---------- 224

  Fly   391 NGKPGAAGISLARVIQMQNNGNANVAAVLSAAANSGSSNSNSNSSSSNTSSNSINTATPQQQVLS 455
                            ||.......|....|.....|.                     |:.:|:
Zfish   225 ----------------MQFTAPHQFAMYEEAMGMQPSM---------------------QRALLT 252

  Fly   456 QRSEKSANGSSKPHHPRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCS 520
            ..|.......|||...|:..    |..:...|.|.:.||.|.||||||||||.|||||||||.|:
Zfish   253 PPSSPLELMESKPKRGRRTW----PRKRMATHTCTYAGCGKTYTKSSHLKAHHRTHTGEKPYHCN 313

  Fly   521 WEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRHM 570
            ||||.|:||||||||||:|||||.:||:|..|:|.||||||||||||||:
Zfish   314 WEGCGWKFARSDELTRHFRKHTGHRPFQCHLCERAFSRSDHLALHMKRHL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 58/103 (56%)
C2H2 Zn finger 489..511 CDD:275368 15/21 (71%)
zf-H2C2_2 503..>519 CDD:290200 14/15 (93%)
C2H2 Zn finger 519..541 CDD:275368 17/21 (81%)
zf-H2C2_2 533..558 CDD:290200 16/24 (67%)
C2H2 Zn finger 549..569 CDD:275368 15/19 (79%)
klf2bNP_571932.1 COG5048 <197..>362 CDD:227381 82/224 (37%)
zf-C2H2 280..304 CDD:278523 16/23 (70%)
C2H2 Zn finger 282..304 CDD:275368 15/21 (71%)
C2H2 Zn finger 312..334 CDD:275368 17/21 (81%)
zf-H2C2_2 326..351 CDD:290200 16/24 (67%)
C2H2 Zn finger 342..362 CDD:275368 15/19 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.