DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and Klf3

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001099212.1 Gene:Klf3 / 114845 RGDID:1593290 Length:344 Species:Rattus norvegicus


Alignment Length:307 Identity:112/307 - (36%)
Similarity:143/307 - (46%) Gaps:71/307 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 LQQQQQQLAVQHLSISPQALGHSNIGSNSPKSSSSSSSNSSNSSSSSHSSSSSISGSSD-----Q 373
            :|.:...|.|......|.|.|       ||.|....|...::...|..|||..|...|.     |
  Rat    57 IQMEPVDLTVNKRGSPPSAAG-------SPSSLKFPSHRRASPGLSMPSSSPPIKKYSPPSPGVQ 114

  Fly   374 PTHSNIPRS---TIVRLTTANG--KPGAAGISLARVIQ---------------------MQNNGN 412
            |  ..:|.|   .:....|.:|  .||...:....|:|                     |.|:.:
  Rat   115 P--FGVPLSMPPVMAAALTRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMDNSNS 177

  Fly   413 ANVAAVLSA----------AANSGSSNSNSNSSSSNTSSNSINTATPQQQVLSQRSEKSANGSSK 467
            .....|:.:          ....|.....::......|...:|:.:|.|.:|.:           
  Rat   178 GMPVPVIESYEKPILQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQE----------- 231

  Fly   468 PHHP-------RQHHSDHSPDA--KRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEG 523
             :||       ::.....|||.  |||||:|.:.||.||||||||||||:|||||||||||:|||
  Rat   232 -NHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEG 295

  Fly   524 CEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRHM 570
            |.|:||||||||||:|||||.|||:|.:|||.||||||||||.||||
  Rat   296 CTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHM 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 65/112 (58%)
C2H2 Zn finger 489..511 CDD:275368 16/21 (76%)
zf-H2C2_2 503..>519 CDD:290200 14/15 (93%)
C2H2 Zn finger 519..541 CDD:275368 17/21 (81%)
zf-H2C2_2 533..558 CDD:290200 18/24 (75%)
C2H2 Zn finger 549..569 CDD:275368 15/19 (79%)
Klf3NP_001099212.1 COG5048 <169..>331 CDD:227381 74/173 (43%)
zf-C2H2 259..283 CDD:278523 17/23 (74%)
C2H2 Zn finger 261..283 CDD:275368 16/21 (76%)
zf-H2C2_2 275..>292 CDD:290200 15/16 (94%)
C2H2 Zn finger 291..313 CDD:275368 17/21 (81%)
zf-H2C2_2 305..330 CDD:290200 18/24 (75%)
C2H2 Zn finger 321..341 CDD:275368 15/19 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.