DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment luna and KLF2

DIOPT Version :9

Sequence 1:	NP_001260879.1	Gene:	luna / 2768719	FlyBaseID:	FBgn0040765	Length:	570	Species:	Drosophila melanogaster
Sequence 2:	NP_057354.1	Gene:	KLF2 / 10365	HGNCID:	6347	Length:	355	Species:	Homo sapiens

Alignment Length:	105	Identity:	70/105 - (66%)
Similarity:	79/105 - (75%)	Gaps:	4/105 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   466 SKPHHPRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFAR 530
            :||...|:..    |..:...|.|.:.||.|.||||||||||.|||||||||.|:|:||.|:|||
Human   255 AKPKRGRRSW----PRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFAR 315

  Fly   531 SDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRHM 570
            |||||||||||||.:||:|..|||.|||||||||||||||
Human   316 SDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM 355

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
luna	NP_001260879.1	COG5048	<455..>559	CDD:227381	57/92 (62%)
		C2H2 Zn finger	489..511	CDD:275368	15/21 (71%)
		zf-H2C2_2	503..>519	CDD:290200	14/15 (93%)
		C2H2 Zn finger	519..541	CDD:275368	17/21 (81%)
		zf-H2C2_2	533..558	CDD:290200	18/24 (75%)
		C2H2 Zn finger	549..569	CDD:275368	16/19 (84%)
KLF2	NP_057354.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..42
		9aaTAD. /evidence=ECO:0000269\|PubMed:31375868	43..51
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	55..90
		Interaction with WWP1. /evidence=ECO:0000250	111..268		4/16 (25%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	120..209
		COG5048	<267..350	CDD:227381	59/82 (72%)
		zf-C2H2	272..296	CDD:278523	16/23 (70%)
		C2H2 Zn finger	274..296	CDD:275368	15/21 (71%)
		zf-H2C2_2	288..>310	CDD:290200	17/21 (81%)
		C2H2 Zn finger	304..326	CDD:275368	17/21 (81%)
		zf-H2C2_2	318..343	CDD:290200	18/24 (75%)
		C2H2 Zn finger	334..354	CDD:275368	16/19 (84%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165151427
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23235
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	4	3.940