DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment luna and klf13

DIOPT Version :9

Sequence 1:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001093690.1 Gene:klf13 / 100101699 XenbaseID:XB-GENE-479837 Length:258 Species:Xenopus tropicalis


Alignment Length:255 Identity:89/255 - (34%)
Similarity:118/255 - (46%) Gaps:50/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 QLAVQHL-SISPQALGH-SNIGSNSPKSSSSSSSNSSNSSSSSHSSSSSISGSSDQPTHSNIPRS 382
            |.|.:.| |:|.:|:.| :.|||...||..||::............::|:.          :...
 Frog     9 QFAAECLVSMSSRAIVHTAPIGSPDGKSQGSSAAPPPAPPGEDRRENASLF----------VVAR 63

  Fly   383 TIVRLTTANGKPG---AAGISLARVIQMQNNGNANVAAVLSAAANSGSSNSNSNSSSSNTSSNSI 444
            .:..|.....|||   ..||||                 |.|        .|...........:.
 Frog    64 ILADLNQQAPKPGEKAECGISL-----------------LPA--------GNEADREPPAGKRAD 103

  Fly   445 NTATPQQQVLSQRSEKSANGSSKPHHPRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSHLKAHQR 509
            ..|||  .:|.:.|.|        ...|:..|...|::..:.|||.:.||:|||.||||||||.|
 Frog   104 RAATP--PLLPEPSPK--------QRARRGKSRCDPESPLKKHKCPYSGCEKVYGKSSHLKAHLR 158

  Fly   510 THTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRH 569
            |||||:|::|||:.|..:|||||||.||||.|||.|.|.|..|::.|.|||||..|.:||
 Frog   159 THTGERPFECSWDECNKKFARSDELARHYRTHTGEKKFSCPICEKRFMRSDHLTKHARRH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 51/103 (50%)
C2H2 Zn finger 489..511 CDD:275368 15/21 (71%)
zf-H2C2_2 503..>519 CDD:290200 12/15 (80%)
C2H2 Zn finger 519..541 CDD:275368 15/21 (71%)
zf-H2C2_2 533..558 CDD:290200 14/24 (58%)
C2H2 Zn finger 549..569 CDD:275368 9/19 (47%)
klf13NP_001093690.1 COG5048 <131..230 CDD:227381 54/88 (61%)
C2H2 Zn finger 138..160 CDD:275368 15/21 (71%)
C2H2 Zn finger 168..190 CDD:275368 15/21 (71%)
C2H2 Zn finger 198..218 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.